Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
FZD10 antibody
The FZD10 antibody is a monoclonal antibody that specifically targets the Frizzled-10 (FZD10) protein. It is composed of amino acid residues and contains a disulfide bond for stability. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.RAF1 antibody
The RAF1 antibody is a highly specialized protein that plays a crucial role in inhibiting leukotriene activity. This antigen-binding antibody is widely used in the field of Life Sciences for research purposes and as a treatment composition. It specifically targets polypeptides involved in the production and signaling of leukotrienes, which are potent mediators of inflammation and immune response. By binding to these polypeptides, the RAF1 antibody effectively neutralizes their activity, offering potential therapeutic benefits for various conditions related to leukotriene dysregulation. With its high specificity and affinity, this polyclonal antibody is an essential tool for scientists and researchers working in the medicinal field.Purity:Min. 95%ACSS2 antibody
The ACSS2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of ACSS2, an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to have high affinity and specificity for ACSS2.C3orf31 antibody
C3orf31 antibody was raised in rabbit using the N terminal of C3ORF31 as the immunogenPurity:Min. 95%C15orf40 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C15orf40 antibody, catalog no. 70R-4542
Purity:Min. 95%NBS1 antibody
The NBS1 antibody is a highly specialized antibody used in Life Sciences research. It is commonly used for the detection and analysis of alpha-fetoprotein (AFP), a biomarker associated with various diseases, including liver cancer. The NBS1 antibody utilizes hybridization techniques to specifically bind to AFP and facilitate its detection.
Purity:Min. 95%HOXC11 protein (His tag)
Please enquire for more information about HOXC11 protein (His tag) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%UBQLN2 antibody
UBQLN2 antibody was raised in rabbit using the N terminal of UBQLN2 as the immunogenPurity:Min. 95%SF3B3 antibody
SF3B3 antibody was raised using the middle region of SF3B3 corresponding to a region with amino acids EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPAOX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PAOX antibody, catalog no. 70R-2927Purity:Min. 95%C7ORF31 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C7orf31 antibody, catalog no. 70R-3267Purity:Min. 95%NR1D1 antibody
NR1D1 antibody was raised using the middle region of NR1D1 corresponding to a region with amino acids SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA
