Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,582 products)
- By Biological Target(100,659 products)
- By Pharmacological Effects(6,931 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(358 products)
- Plant Biology(6,909 products)
- Secondary Metabolites(14,365 products)
Found 130413 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
KIF2B antibody
KIF2B antibody was raised using the middle region of KIF2B corresponding to a region with amino acids DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKKPurity:Min. 95%LDOC1 antibody
LDOC1 antibody was raised in rabbit using the N terminal of LDOC1 as the immunogenPurity:Min. 95%ING1 antibody
The ING1 antibody is a polyclonal antibody that specifically targets the colony-stimulating factor known as acidic m-CSF. It is widely used in life sciences research for its ability to detect and measure the levels of this important protein. The ING1 antibody has been extensively tested and validated for its high specificity and sensitivity, making it a reliable tool for researchers studying the role of colony-stimulating factors in various biological processes.
Synaptogyrin 4 antibody
Synaptogyrin 4 antibody was raised using the N terminal of SYNGR4 corresponding to a region with amino acids MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKMPurity:Min. 95%Goat anti Rabbit IgG (Fab'2) (FITC)
Goat anti-rabbit IgG (Fab'2) (FITC) was raised in goat using rabbit IgG F(c) fragment as the immunogen.
Purity:Min. 95%MAP4K4 antibody
MAP4K4 antibody was raised in Mouse using a purified recombinant fragment of MAP4K4(aa400-500) expressed in E. coli as the immunogen.GOLGA7 antibody
GOLGA7 antibody was raised in rabbit using the N terminal of GOLGA7 as the immunogenPurity:Min. 95%ZC3H11A antibody
The ZC3H11A antibody is a polyclonal antibody that specifically targets the ZC3H11A protein, a nuclear protein involved in various biological processes. This antibody is widely used in Life Sciences research for the detection and analysis of ZC3H11A expression levels. It can be used for prophylaxis and/or therapeutic purposes, as it has shown promising results in studies related to certain diseases and conditions. The ZC3H11A antibody is highly specific and sensitive, making it an excellent tool for researchers working with polynucleotide sequences and studying nuclear proteins. Whether you are conducting basic research or developing new diagnostic tools, this antibody can provide valuable insights into the functions and mechanisms of ZC3H11A.Mature Macrophage Marker antibody (biotin)
Mouse monoclonal Mature Macrophage Marker antibody (biotin)KDM1A (493-507) Heavy
Lysine-specific histone demethylase 1A (LSD1) or lysine (K)-specific demethylase 1A (KDM1A) is a protein in humans that encodes a flavin-dependent monoamine oxidase. The KDM1A protein can demethylate mono- and di-methylated lysines, specifically histone 3, lysines 4 and 9. KDM1A has crucial roles in embryogenesis and tissue-specific differentiation, as well as oocyte growth. KDM1A also appears to play a clinically important role in epigenetic reprogramming zygote formation. Deletion of the gene for KDM1A can have effects on the growth and differentiation of embryonic stem cells. KDM1A is also thought to play a role in cancer, as poorer outcomes can be correlated with higher expression of this gene. Therefore, the inhibition of KDM1A may be a possible treatment for cancer.The lysine residue at position 15 of this peptide is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (2).Purity:Min. 95%Molecular weight:1,788.9 g/molGABRB3 antibody
GABRB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAPurity:Min. 95%
