Biochemicals and Reagents

Complement component C9 is a fundamental factor of the complement system where several subunits of C9 form a complex with C5b, C6, C7 and C8 to generate the membrane attack complex (MAC). The MAC produces pores in the bacterial membrane thus causing a Ca2+ influx into the cell and bacterial cell death.C9 is a member of the Mac perforin-like superfamily. These all have a thrombospondin-1 domain, a low-density lipoprotein receptor-associated domain, a MACPF domain and an epidermal growth factor domain. Moreover C9 has the ability to form poly-C9 which can from structures similar to that of the MAC pore.Overall the main function of the complement system is to mark cells for phagocytosis, the recruitment of inflammatory cells and the cell lysis of bacteria cells by the MAC. The complement system as a whole can be associated with the neurological diseases, bacterial meningitis, thrombotic disorders, neurological and autoimmune diseases.The leucine residue at position 7 has been isotopically labelled with carbon-13 (6) and nitrogen-15 (1).

The RREB1 antibody is a powerful tool used in Life Sciences for various applications. This antibody specifically targets the RREB1 protein, which plays a crucial role in regulating gene expression and cellular processes. By binding to RREB1, this antibody can be used to study its function and activity in different biological systems.

CK2 alpha 1 antibody was raised using the middle region of CSNK2A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP

C1orf106 antibody was raised in Rabbit using Human C1orf106 as the immunogen

The PUF60 antibody is a polyunsaturated polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and bind to the PUF60 protein, which plays a crucial role in various cellular processes such as glucagon and chemokine signaling. This antibody has been extensively tested and validated for its reactivity against a wide range of test substances including mda-mb-231 cells, reactive polymers, oligodeoxynucleotides, and more. The PUF60 antibody is highly specific and exhibits strong binding affinity, making it an ideal tool for various applications such as immunohistochemistry, Western blotting, chromatographic techniques, and electrophoresis. Whether you are conducting research or developing new therapeutics, this high-quality monoclonal antibody will provide accurate and reliable results.

Lysine-specific histone demethylase 1A (LSD1) or lysine (K)-specific demethylase 1A (KDM1A) is a protein in humans that encodes a flavin-dependent monoamine oxidase. The KDM1A protein can demethylate mono- and di-methylated lysines, specifically histone 3, lysines 4 and 9. KDM1A has crucial roles in embryogenesis and tissue-specific differentiation, as well as oocyte growth. KDM1A also appears to play a clinically important role in epigenetic reprogramming zygote formation. Deletion of the gene for KDM1A can have effects on the growth and differentiation of embryonic stem cells. KDM1A is also thought to play a role in cancer, as poorer outcomes can be correlated with higher expression of this gene. Therefore, the inhibition of KDM1A may be a possible treatment for cancer.The arginine residue at position 7 of this peptide is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (4).

Rabbit polyclonal UGT2B4 antibody

The LTA4H antibody is a monoclonal antibody that specifically targets the LTA4H protein. This protein plays a crucial role in various biological processes, including inflammation and immune response. The LTA4H antibody has been extensively studied for its potential therapeutic applications in diseases such as cancer, autoimmune disorders, and neurodegenerative diseases.

Rabbit polyclonal MAP1S antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZMPSTE24 antibody, catalog no. 70R-7342

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF527 antibody, catalog no. 20R-1247

The TSC2 antibody is a highly effective growth factor that plays a crucial role in various Life Sciences applications. It has been extensively studied for its ability to regulate osteopontin and e-cadherin expression, making it an invaluable tool in research and experimentation. This polyclonal antibody offers exceptional hybridization capabilities, allowing for accurate detection and analysis of target proteins. Additionally, the TSC2 antibody has shown promising results in inhibiting angptl3 and anti-cd33 activity, further expanding its potential applications. With its specificity towards e-cadherin and β-catenin, this monoclonal antibody provides precise targeting for adipose-related studies. Whether you're conducting basic research or developing therapeutic interventions, the TSC2 antibody is an essential tool for any scientist looking to delve into the intricacies of cellular signaling pathways and protein interactions.

PRSS2 protein is a plasma protein that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. PRSS2 protein can be detected and measured in plasma levels, making it a valuable tool for studying its functions and interactions with other molecules.

GABBR2 antibody was raised in Rabbit using Human GABBR2 as the immunogen

Rabbit polyclonal IF3EI antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM28 antibody, catalog no. 70R-4708

EML3 antibody was raised using the N terminal of EML3 corresponding to a region with amino acids LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI