Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,620 products)
- By Biological Target(100,451 products)
- By Pharmacological Effects(6,928 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,363 products)
Found 130328 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CCR7 antibody
CCR7 antibody was raised in goat using a synthetic peptide DPGKPRKNVLVVALLVIFQVC corresponding to amino acid residues 2-22 of mouse CCR7 as the immunogen.Purity:Min. 95%ADH1B antibody
ADH1B antibody was raised using a synthetic peptide corresponding to a region with amino acids STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDAnnexin A2 antibody
The Annexin A2 antibody is a highly specific monoclonal antibody that targets the human protein Annexin A2. This antibody is designed to recognize and bind to Annexin A2, which plays a crucial role in various cellular processes.Tel antibody
Tel antibody is a polyclonal antibody that targets the telomerase enzyme, which plays a crucial role in cell division and aging. This antibody specifically binds to the catalytic subunit of telomerase, inhibiting its activity and preventing further cell proliferation. Tel antibody has been extensively used in life sciences research to study telomere biology and its implications in various diseases, including cancer.
NMDAR2B antibody
The NMDAR2B antibody is a highly specialized antibody that targets the N-methyl-D-aspartate receptor subunit 2B (NMDAR2B). This antibody is commonly used in research and diagnostic applications to study the role of NMDAR2B in various biological processes. It has been extensively tested and validated for its specificity and sensitivity.Purity:Min. 95%TRIM55 antibody
TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ
CSFR antibody
The CSFR antibody is a monoclonal antibody that specifically targets colony-stimulating factor receptors (CSFRs). These receptors play a crucial role in the regulation of immune cell production and activation. By binding to CSFRs, this antibody inhibits the activation of protein kinases and phosphatases, which are essential for the growth and survival of immune cells.C20ORF10 antibody
C20ORF10 antibody was raised using the N terminal Of C20Orf10 corresponding to a region with amino acids RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN
Purity:Min. 95%
