Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,757 products)
- By Biological Target(100,261 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
MAX antibody
MAX antibody was raised in rabbit using the n terminal of MAX as the immunogenPurity:Min. 95%Epsilon Tubulin 1 antibody
Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA
Purity:Min. 95%FGFR1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.ZNHIT3 antibody
ZNHIT3 antibody was raised in rabbit using the N terminal of ZNHIT3 as the immunogenPurity:Min. 95%Leptin antibody
The Leptin antibody is a monoclonal antibody that targets and neutralizes the activity of leptin, a hormone involved in regulating appetite and metabolism. It has been shown to inhibit the binding of leptin to its receptor, thereby reducing its signaling pathway. This antibody also has inhibitory effects on factors such as IFN-gamma, alpha-fetoprotein, chemokines, and basic proteins. Additionally, it has been found to have glycosylation and β-catenin inhibitory properties. The Leptin antibody is formulated with excipients and is available as a vitamin D-binding inhibitor.
SLC41A3 antibody
SLC41A3 antibody was raised using the C terminal of SLC41A3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFIPurity:Min. 95%Cimaterol antibody
The Cimaterol antibody is a polyclonal antibody that specifically targets and binds to Cimaterol, an agonist protein. This antibody can be used in various life science research applications, including the study of chemokines and growth factors. It has been extensively tested and shown to be highly specific and sensitive in detecting Cimaterol in human serum. The Cimaterol antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. Additionally, this antibody has neutralizing properties, making it suitable for functional studies and potentially therapeutic applications. With its high quality and reliability, the Cimaterol antibody is a valuable tool for scientists working in the field of drug development, immunology, and related areas.Purity:Min. 95%SIPA1 antibody
SIPA1 antibody was raised using the middle region of SIPA1 corresponding to a region with amino acids TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS
Purity:Min. 95%CD2 antibody
The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which is involved in cell adhesion and signaling. This antibody can be used in various research applications in the field of life sciences. It has been shown to interact with chemokines, endogenous hematopoietic antibodies, alpha-fetoprotein, actin antibody, human folate, interferon, and growth factors. The CD2 antibody specifically binds to CD2 receptors on the surface of cells and can be used for immunohistochemistry, flow cytometry, and other experimental techniques. Its high specificity and affinity make it a valuable tool for studying cellular processes and identifying specific cell types.Slc9a3r2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Slc9a3r2 antibody, catalog no. 70R-8580
Purity:Min. 95%BAY-1436032
CAS:BAY-1436032 is a novel small molecule inhibitor of CXCR4. It has been shown to be an effective treatment for cancer in vitro, with potent inhibition of cancer cell growth and anti-leukemic activity. BAY-1436032 is orally bioavailable and has good pharmacokinetic properties. It binds specifically to the CXCR4 receptor, blocking the binding of stromal cell-derived factor 1α (SDF1α) and its chemokine ligand 4 (CXCL4). This drug has also been shown to inhibit the proliferation of leukemia stem cells in vitro and in vivo, as well as suppressing sarcoma cell growth.
Formula:C26H30F3N3O3Purity:Min. 95%Molecular weight:489.53 g/molRabbit anti Human IgG (FITC)
Rabbit anti-human IgG (FITC) was raised in rabbit using human IgG Fc fragment as the immunogen.Purity:Min. 95%HSPBP1 antibody
The HSPBP1 antibody is a monoclonal antibody that specifically targets collagen. It is an 8-substituted antibody that has been developed for its high affinity and specificity towards collagen. This antibody can be used in various applications within the field of life sciences, including research and diagnostic purposes.Rabbit anti Sheep IgG (Texas Red)
Rabbit anti-sheep IgG was raised in rabbit using heep IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%CAV1 antibody
CAV1 antibody was raised in rabbit using the N terminal of CAV1 as the immunogenPurity:Min. 95%
