Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,757 products)
- By Biological Target(100,261 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
NTSR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NTSR1 antibody, catalog no. 70R-6966Purity:Min. 95%Phospholamban antibody
The Phospholamban antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize phospholamban, an inhibitory factor involved in the regulation of calcium uptake and release in cardiac muscle cells. This antibody has been extensively tested and shown to effectively lyse phospholamban-expressing cells, making it a valuable tool for researchers studying the role of phospholamban in various physiological processes. Additionally, this antibody has also been found to have neutralizing effects on certain autoantibodies, such as antiphospholipid antibodies, and can modulate the activity of colony-stimulating factors like GM-CSF. With its high specificity and potency, the Phospholamban antibody is an essential component for any research project involving phospholamban or related proteins.
DBI Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DBI antibody, catalog no. 70R-2557
Purity:Min. 95%FGFBP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FGFBP2 antibody, catalog no. 70R-10120
Purity:Min. 95%Norovirus G2 antibody
The Norovirus G2 antibody is a monoclonal antibody used in life sciences research. It specifically targets the G2 strain of the norovirus, which is a common cause of gastroenteritis. This antibody can be used to detect and study the protein expression of norovirus in various samples, including nuclear extracts, lysozyme, alpha-fetoprotein, and glycopeptides. The monoclonal antibody recognizes specific glycosylation patterns on the norovirus protein, allowing for accurate detection and analysis. It has also been used in studies related to androgen signaling in human serum and arginase activity. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying norovirus and its impact on human health.C6ORF201 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf201 antibody, catalog no. 70R-4814
Purity:Min. 95%FAM129A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM129A antibody, catalog no. 70R-1294Purity:Min. 95%GPR56 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPR56 antibody, catalog no. 70R-7463Purity:Min. 95%CROT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CROT antibody, catalog no. 70R-1109
Purity:Min. 95%MEF2A antibody
The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.
Purity:Min. 95%PRDX6 antibody
PRDX6 antibody was raised using the C terminal of PRDX6 corresponding to a region with amino acids VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQPCD117 antibody
The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.
