Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Tubulin beta antibody
The Tubulin beta antibody is a highly effective neutralizing agent that targets the carbonic region of the tubulin beta protein. This monoclonal antibody has been specifically designed to bind to and inhibit the activity of tubulin beta, which plays a crucial role in cell division and growth. By blocking the function of tubulin beta, this antibody prevents the formation of microtubules, which are essential for cellular processes such as mitosis and intracellular transport.5,7-Dimethoxyluteolin
CAS:5,7-Dimethoxyluteolin is a natural product and research tool. It is a ligand that binds to the G-protein coupled receptor protein and activates it. 5,7-dimethoxylyteolin is an activator of the ion channel TRPV2 and inhibits the activity of the potassium channel Kv1.3. It has also been shown to inhibit the production of prostaglandin E2 in human platelets. 5,7-dimethoxyluteolin is used in cell biology to study protein interactions and has been used as an inhibitor in pharmacology studies on peptides and life sciences.Formula:C17H14O6Purity:Min. 95%Molecular weight:314.29 g/molCOL4A2 antibody
The COL4A2 antibody is an inhibitory factor that targets chemokines and plays a crucial role in various biological processes. This monoclonal antibody specifically binds to annexin A2, a protein involved in cell adhesion and signal transduction. By neutralizing the activity of annexin A2, the COL4A2 antibody can inhibit the migration and invasion of cancer cells. Additionally, this antibody has been shown to have natriuretic effects, promoting diuresis and reducing blood pressure. In Life Sciences research, the COL4A2 antibody is commonly used as a tool to study autoantibodies and their role in disease development. Whether you need a monoclonal or polyclonal antibody, the COL4A2 antibody is an essential reagent for studying activated pathways and investigating potential therapeutic targets.APC antibody
The APC antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It has been extensively studied for its ability to interact with alpha-synuclein, a protein associated with neurodegenerative disorders such as Parkinson's disease. This antibody specifically targets and binds to tyrosine residues on alpha-synuclein, inhibiting its aggregation and promoting its clearance from the brain.PRDX2 antibody
PRDX2 antibody was raised using the middle region of PRDX2 corresponding to a region with amino acids VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDNFH antibody
NFH antibody was raised in rabbit using repeated motif, XKSPYK domain [SPEKAKSPEKAKSC] of NFH as the immunogen.Purity:Min. 95%DPP4 antibody
DPP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%ZNF474 antibody
ZNF474 antibody was raised in rabbit using the middle region of ZNF474 as the immunogenPurity:Min. 95%PRD antibody
PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRLNUDT16L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT16L1 antibody, catalog no. 70R-8788Purity:Min. 95%eIF4G antibody
The eIF4G antibody is a reactive monoclonal antibody that specifically targets the cysteine-rich protein eIF4G. This protein is activated in response to chemokines and plays a crucial role in various cellular processes related to Life Sciences. The eIF4G antibody has been extensively studied and shown to inhibit transmembrane conductance, human chemokine signaling pathways, and annexin activity. It is a valuable tool for researchers studying the function of eIF4G and its interactions with other proteins such as TNF-α and growth factors. Additionally, this monoclonal antibody can be used in assays involving phosphatase activity or as a cytotoxic agent in certain experimental setups. Trust the eIF4G antibody to provide accurate and reliable results in your research endeavors.
Purity:Min. 95%CDK2 antibody
The CDK2 antibody is an essential tool in the field of Life Sciences. It is an antigen that has antiviral properties and can be used to neutralize harmful viruses. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.
TRAF7 antibody
TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPRPurity:Min. 95%GTPBP2 antibody
GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEHArsg antibody
Arsg antibody was raised in rabbit using the C terminal of Arsg as the immunogenPurity:Min. 95%Keratin K18 antibody
Keratin K18 antibody was raised in Guinea Pig using Acidic human keratin K18 as the immunogen.Purity:Min. 95%
