Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130563 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
TLK1 antibody
TLK1 antibody was raised using the N terminal of TLK1 corresponding to a region with amino acids ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGPurity:Min. 95%RAB1A antibody
The RAB1A antibody is a highly specific antibody that targets the RAB1A protein. RAB1A is a small GTPase that plays a crucial role in intracellular vesicular transport. It is involved in the regulation of membrane trafficking, including the transport of proteins from the endoplasmic reticulum to the Golgi apparatus.DSP-2230
CAS:DSP-2230 is a study drug that is designed to block the sodium channel. It has been shown to be safe and well tolerated in humans, with no significant side effects. DSP-2230 showed potential to reduce symptoms of neuropathic pain in human subjects and was tested for its ability to block radiation-induced damage to DNA. In addition, it inhibits the activity of ultraviolet (UV) radiation on women's skin. The mechanism of action in this case is not known, but may involve inhibiting the production of reactive oxygen species and/or blocking UV-induced increases in DNA strand breaks.Formula:C20H20F3N5O2Purity:Min. 95%Molecular weight:419.4 g/molHMGCS1 protein
HMGCS1 protein is a key enzyme involved in the biosynthesis of cholesterol. It plays a crucial role in regulating cholesterol levels in the body. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various research studies.
Purity:Min. 95%Neuromedin B (Human, Porcine, Rat)
CAS:Neuromedin B is a neuropeptide that has been shown to activate the TRPC ion channels in mammalian cells. It also has been shown to bind to receptors and have a potent effect on cell biology, as well as being used as a research tool for studying protein interactions. Neuromedin B is found in humans, pigs, and rats, where it is expressed primarily in the brain and gastrointestinal tract. This peptide has been shown to be an inhibitor of some types of ion channels.Formula:C52H73N15O12SPurity:Min. 95%Molecular weight:1,132.3 g/molAc-Asp-Glu • H2O
CAS:Ac-Asp-Glu • H2O is a water soluble molecule that belongs to the class of inhibitors. It has been shown to inhibit the polymerase chain reaction and is used as an analytical method for detecting DNA sequences. Ac-Asp-Glu • H2O induces neuronal death in the caudate putamen, thereby causing bowel disease, by inhibiting energy metabolism. This compound also inhibits the synthesis of proteins in the hippocampus, which leads to reduced locomotor activity and eosinophil cationic protein production. Ac-Asp-Glu • H2O is acidic and its concentration–time curve shows a bell shape. The half life of this compound is six hours.Formula:C11H16N2O8•H2OPurity:Min. 95%Molecular weight:322.28 g/molBMS 200150 hydrochloride
CAS:Microsomal triglyceride transfer protein (MTP) inhibitor
Formula:C28H30N2O•HClPurity:Min. 95%Molecular weight:447.01 g/molEndothelin-1 (Human)
CAS:Endothelin-1 is a peptide that acts as a vasoconstrictor and plays an important role in the regulation of blood pressure. Endothelin-1 is also an endogenous ligand for two G protein-coupled receptors, ETA and ETB. Interesting Endothelin-1 is the most abundant isoform and is expressed in endothelial cells of every blood vessel. It exerts its vasoconstrictor effects through binding to ETA receptors located on the smooth muscle. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11, sourced from Porcine, Canine, Rat, Mouse and Bovine and is available as a 0.5mg vial.Formula:C109H159N25O32S5Purity:Min. 95%Molecular weight:2,491.9 g/molS49076
CAS:S49076 is a quinoline derivative that has been shown to inhibit the growth of tumors in animal models by inhibiting epidermal growth factor receptor. S49076 is also able to inhibit the activation of H3 histones, which are important for gene transcription. The drug has been shown to be safe in preclinical studies, and clinical trials are currently ongoing for the treatment of cancer.
Formula:C22H22N4O4SPurity:Min. 95%Molecular weight:438.5 g/molD-JNKI-1
CAS:D-JNKI-1 is a synthetic peptide inhibitor, specifically targeting the c-Jun N-terminal kinase (JNK) pathway. It is developed from a human-derived sequence, incorporating a D-enantiomer configuration to enhance stability and resistance to proteolytic degradation. The mode of action involves the competitive inhibition of JNK's interaction with its substrates, effectively blocking the phosphorylation and subsequent activation of downstream targets. This inhibitory mechanism is achieved by binding directly to the JNK protein, preventing it from executing its usual signaling responsibilities.Formula:C164H286N66O40Purity:Min. 95%Molecular weight:3,822.4 g/molCarbonic Anhydrase VIII antibody
Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ2-[Bis(2-hydroxyethyl)amino]benzo[H]chromen-4-one
CAS:2-[Bis(2-hydroxyethyl)amino]benzo[H]chromen-4-one is a peptide that can be used as a research tool. It has been shown to activate the ion channel TRPV1 and TRPV4, which are part of the transient receptor potential (TRP) family of ion channels. This peptide is an inhibitor of protein interactions such as antibody-antigen interactions and receptor-ligand interactions. 2-[Bis(2-hydroxyethyl)amino]benzo[H]chromen-4-one is also a receptor ligand for the G protein coupled receptors GPR37 and GPR38.
Formula:C17H17NO4Purity:Min. 95%Molecular weight:299.32 g/molSulfocostunolide B
CAS:Sulfocostunolide B is a dibutyl, ursolic, betulinic acid, which belongs to the group of lactones. It has been synthesized by techniques that include chromatographic and spectroscopic methods. Sulfocostunolide B is found in plants such as costunolide and ursolic acid. The molecule has an acid group that can be used for reactions with amino acids or other molecules to produce derivatives.Formula:C15H20O5SPurity:Min. 95%Molecular weight:312.4 g/mol
![2-[Bis(2-hydroxyethyl)amino]benzo[H]chromen-4-one](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FUCA54104.webp&w=3840&q=75)
