Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,560 products)
- By Biological Target(101,036 products)
- By Pharmacological Effects(6,953 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Malachite Green antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through various studies, including the use of a patch-clamp technique on human erythrocytes. Metabolized through several metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains. This compound also inhibits cell growth in culture and shows great promise in combating tuberculosis infections.Purity:Min. 95%FZD9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FZD9 antibody, catalog no. 70R-7131
Purity:Min. 95%DAZ4 antibody
DAZ4 antibody was raised using the N terminal of DAZ4 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARHIV1 antibody (HTLV3)
HIV1 antibody (HTLV3) was raised in goat using human isolate, highly pure HIV1 as the immunogen.Aste1 antibody
Aste1 antibody was raised in rabbit using the middle region of Aste1 as the immunogenPurity:Min. 95%SEMA3C antibody
The SEMA3C antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively studied for its ability to inhibit the activity of interleukin-6 (IL-6), a multifunctional cytokine involved in various biological processes. This antibody has also shown promising results in inhibiting multidrug resistance and TGF-beta signaling.
EpCAM antibody
The EpCAM antibody is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM). It has been widely used in various applications within the field of Life Sciences. The EpCAM antibody has proven to be highly effective in detecting and quantifying alpha-fetoprotein (AFP), a protein commonly associated with liver cancer, as well as in studying breast cancer cells such as MCF-7.
RNF20 antibody
RNF20 antibody was raised using the N terminal of RNF20 corresponding to a region with amino acids LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS
