Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,563 products)
- By Biological Target(101,038 products)
- By Pharmacological Effects(6,954 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130636 products of "Biochemicals and Reagents"
GLS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLS2 antibody, catalog no. 70R-1110Purity:Min. 95%MAGEB1 antibody
MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS
HMGB1 protein
1-215 amino acids: MGKGDPKKPR GKMSSYAFFV QTCREEHKKK HPDASVNFSE FSKKCSERWK TMSAKEKGKF EDMAKADKAR YEREMKTYIP PKGETKKKFK DPNAPKRPPS AFFLFCSEYR PKIKGEHPGL SIGDVAKKLG EMWNNTAADD KQPYEKKAAK LKEKYEKDIA AYRAKGKPDA AKKGVVKAEK SKKKKEEEED EEDEEDEEEE EDEEDEDEEE DDDDELEHHH HHHPurity:Min. 95%Testosterone Antibody
The Testosterone Antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It is specifically designed to target and bind to testosterone, a steroid hormone that plays a crucial role in various physiological processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.HOXA9 antibody
HOXA9 antibody was raised in rabbit using the middle region of HOXA9 as the immunogenPurity:Min. 95%Cytokeratin 23 antibody
Cytokeratin 23 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR
Zopiclone antibody
The Zopiclone antibody is a monoclonal antibody that has cytotoxic properties. It targets interleukin-6, a transmembrane conductance protein involved in human chemokine signaling. This antibody can be used in Life Sciences research to study the effects of IL-6 on various cellular processes. Additionally, it can be used as a medicament for the treatment of diseases related to IL-6 dysregulation. The Zopiclone antibody is also effective against oncogenic kinases and cysteine-rich proteins, making it a valuable tool for cancer research. Furthermore, it has been shown to enhance the activity of histone deacetylase inhibitors and inhibit the production of TNF-α, an inflammatory cytokine. With its specific targeting capabilities and diverse applications, the Zopiclone antibody is an essential component in the field of Antibodies and monoclonal antibodies.
Purity:Min. 95%HSPA4L antibody
HSPA4L antibody was raised using the C terminal of HSPA4L corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
Matrin 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MATR3 antibody, catalog no. 70R-1389Purity:Min. 95%RSV antibody
RSV antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the respiratory syncytial virus (RSV), a common cause of respiratory infections in humans, especially in infants and young children. The RSV antibody is derived from human serum and has been developed to have high affinity and specificity for RSV antigens. It can be used in various applications, such as immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), and Western blotting, to detect and quantify RSV proteins. The RSV antibody is also capable of neutralizing the virus by preventing its entry into host cells or inhibiting viral replication. This makes it a valuable tool for studying the mechanisms of RSV infection and developing potential therapies or vaccines against this respiratory pathogen. Additionally, the RSV antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, for visualization or quantification purposes in research experiments. With its high specificity and versatility
PAPPA antibody
The PAPPA antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and inhibit the activity of Pregnancy-Associated Plasma Protein-A (PAPPA), which plays a crucial role in various biological processes.TGFB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TGFB1 antibody, catalog no. 70R-8230Purity:Min. 95%AQP3 antibody
The AQP3 antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets nucleotide molecules and has shown high affinity for the anti-HER2 antibody trastuzumab. This antibody plays a crucial role in research and diagnostics by detecting and quantifying the presence of specific proteins or antigens.Purity:Min. 95%p8 antibody
p8 antibody was raised in rabbit using C terminus of the human p8 protein as the immunogen.Purity:Min. 95%
