Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
DPF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DPF1 antibody, catalog no. 70R-8033
Purity:Min. 95%IFIT5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IFIT5 antibody, catalog no. 70R-5819Purity:Min. 95%GTPBP9 antibody
GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND
Tfdp1 antibody
Tfdp1 antibody was raised in rabbit using the N terminal of Tfdp1 as the immunogenPurity:Min. 95%Carbonic anhydrase protein
Carbonic anhydrase protein is a vital component of the body's enzyme system. It plays a crucial role in maintaining the pH balance and regulating various physiological processes. This protein has been extensively studied in Life Sciences and has shown promising results in various applications.Purity:Min. 95%RIPX antibody
RIPX antibody was raised in rabbit using the C terminal of RIPX as the immunogenPurity:Min. 95%HAAO Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HAAO antibody, catalog no. 70R-2592Purity:Min. 95%EGFR antibody
The EGFR antibody is a highly effective monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It is designed to bind to the EGFR protein and inhibit its activity, thereby preventing the growth and proliferation of cancer cells. This antibody has been extensively studied in the field of life sciences and has shown promising results in various preclinical and clinical trials.Purity:Min. 95%TSHR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSHR antibody, catalog no. 70R-1187Purity:Min. 95%PRDM1 antibody
PRDM1 antibody was raised in Mouse using a purified recombinant fragment of human PRDM1 expressed in E. coli as the immunogen.Thrombomodulin antibody
Thrombomodulin antibody is a monoclonal antibody that specifically targets thrombomodulin, an extracellular protein involved in blood coagulation and inflammation. This antibody has cytotoxic effects on cells expressing alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. It has been shown to reduce microvessel density and inhibit the formation of actin filaments in vitro. Thrombomodulin antibody can be used in life sciences research to study the role of thrombomodulin in various biological processes and as a potential therapeutic agent for conditions involving abnormal blood clotting or inflammation.Goat anti Rabbit IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%IFRD1 antibody
IFRD1 antibody was raised using the middle region of IFRD1 corresponding to a region with amino acids LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF
LHX2 antibody
The LHX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It acts as a neutralizing agent against a specific antigen, targeting low-density lipoprotein (LDL) receptors. This soluble antibody binds to LDL receptors and prevents the uptake of LDL particles into cells. By blocking this process, it helps researchers study the role of LDL receptors in various biological processes.SSB antibody
The SSB antibody is a specific antibody that belongs to the class of monoclonal antibodies. It has neutralizing properties and can be used in various applications in the field of Life Sciences. This antibody is commonly used in research to study the function of SSB (single-stranded DNA-binding protein) and its role in various biological processes.
