Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130563 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Centa1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Centa1 antibody, catalog no. 70R-9159Purity:Min. 95%TMEM48 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM48 antibody, catalog no. 70R-7214
Purity:Min. 95%MYC antibody
The MYC antibody is a highly versatile and potent tool used in various fields such as Life Sciences, industrial applications, and molecular modeling. This antibody exhibits antioxidant activity and has been shown to have an inhibitory effect on protein kinase, making it a valuable asset in the study of cellular processes. The MYC antibody is available as both monoclonal antibodies and polyclonal antibodies, providing researchers with options that best suit their experimental needs. With its ability to specifically bind to activated MYC proteins, this antibody enables accurate detection and analysis of MYC expression levels. Additionally, the MYC antibody can be utilized in molecular docking studies and cyclic peptide development for drug discovery purposes.SLC6A18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A18 antibody, catalog no. 70R-1802Purity:Min. 95%PLUNC Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLUNC antibody, catalog no. 70R-5913Purity:Min. 95%FTH1 antibody
FTH1 antibody was raised using the middle region of FTH1 corresponding to a region with amino acids NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMPurity:Min. 95%Melatonin-BSA
Melatonin BSA is an inhibitory factor that binds to proteins in the body, including tumor necrosis factor-alpha (TNF-α). It has been shown to have effects on adipose tissue and can be used as a monoclonal antibody for research purposes. Melatonin BSA also interacts with the growth hormone receptor and has anti-glial fibrillary acidic protein (GFAP) activity. This protein is commonly found in human serum and can be used in various life science applications. Melatonin BSA has activated and neutralizing properties, making it a versatile tool for studying proteins and antigens.Purity:Min. 95%DOK6 antibody
DOK6 antibody was raised using the middle region of DOK6 corresponding to a region with amino acids IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLITRAK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRAK1 antibody, catalog no. 70R-4215Purity:Min. 95%RHOX11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RHOX11 antibody, catalog no. 70R-8214Purity:Min. 95%Myeloperoxidase antibody
Myeloperoxidase antibody was raised in rabbit using myeloperoxidase from human Leukocytes as the immunogen.Purity:Min. 95%Caly Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Caly antibody, catalog no. 70R-8672Purity:Min. 95%HSPA8 antibody
HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLAKT1 antibody
The AKT1 antibody is a highly effective monoclonal antibody that is used as a medicament for various therapeutic purposes. It specifically targets and binds to AKT1 dimers, inhibiting their activity. This antibody has been shown to have neutralizing effects against TNF-α, a potent pro-inflammatory cytokine involved in various diseases. Additionally, the AKT1 antibody can recognize and bind to specific glycopeptide structures on glycan molecules, leading to the inhibition of certain biological processes. It has also demonstrated its efficacy in targeting globulins and glycoproteins, including chemokines. The AKT1 antibody is widely used in research and clinical settings for its ability to modulate cellular signaling pathways and regulate important physiological functions.
ERGIC3 antibody
ERGIC3 antibody was raised using the C terminal of ERGIC3 corresponding to a region with amino acids LTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTTPurity:Min. 95%Goat anti Mouse IgG (H + L)
Goat anti-mouse IgG (H+L) was raised in goat using murine IgG, whole molecule as the immunogen.Purity:Min. 95%
