Biochemicals and Reagents

Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase essential for regulating cellular growth, survival, metabolism, and proliferation. Functioning within the PI3K/Akt/mTOR pathway, Akt responds to signals from growth factors or insulin to help cells adapt and maintain function. There are three Akt isoforms in humans—Akt1, Akt2, and Akt3—each encoded by distinct genes. Akt activation begins when these signals bind to receptors on the cell surface, activating phosphoinositide 3-kinase (PI3K), which produces PIP3 on the cell membrane. This attracts Akt to the membrane, where it becomes fully active through phosphorylation at Thr308 and Ser473, allowing it to move within the cell to phosphorylate proteins in key pathways.Akt’s primary roles include promoting cell survival by inhibiting apoptosis through inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also drives cell growth and proliferation by activating mTOR, a main regulator of protein synthesis, while suppressing growth-inhibiting pathways. In metabolic regulation, Akt increases glucose uptake and glycolysis, particularly in muscle and fat tissues, through GLUT4 translocation and hexokinase activation. Additionally, Akt promotes angiogenesis by upregulating VEGF to support tissue repair and contributes to cell migration, aiding wound healing and, in cancers, tumor spread. Its broad role in cell growth and survival often leads to hyperactivation in cancers, making it a target in cancer therapies, while its influence on glucose metabolism links it to insulin signaling, where pathway defects can lead to insulin resistance and type 2 diabetes.

Purified recombinant IL1RL1 protein (Fc Chimera)

Rabbit polyclonal APT2 antibody (HRP)

Goat anti-bovine IgG (H + L) (Alk Phos) was raised in goat using bovine IgG (H & L) as the immunogen.

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

Rabbit polyclonal SMARCD1 antibody

Rabbit Polyclonal PKC mu antibody

Reagent Grade Bovine Serum Albumin (99% pure)

JMJD5 antibody was raised in rabbit using the N terminal of JMJD5 as the immunogen

Mouse monoclonal Toll-like receptor 1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GALNTL4 antibody, catalog no. 70R-6589

Goat anti-rat IgG (H+L) (Alk Phos) was raised in goat using rat IgG whole molecule as the immunogen.

The ODF1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of antiphospholipid antibodies and falls under the broader umbrella of Antibodies. This antibody specifically targets chemokine receptors and is available in both polyclonal and monoclonal forms.

Mouse monoclonal ERCC4 antibody

TCL1A antibody was raised using the N terminal of TCL1A corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL

FOXA2 antibody is a monoclonal antibody that is widely used in Life Sciences research. It specifically targets the FOXA2 protein, which plays a crucial role in various cellular processes such as exocytosis and galactose metabolism. This antibody can be used for a variety of applications including immunohistochemistry, immunofluorescence, and western blotting. Additionally, it has been shown to have high specificity and sensitivity in detecting FOXA2 in various biological samples. The FOXA2 antibody is also commonly used in studies investigating the role of FOXA2 in nuclear organization, histone H3 modifications, and gene regulation. Its alkaline phosphatase conjugate allows for easy detection and visualization of the antigen of interest.