Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,556 products)
- By Biological Target(100,854 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(528 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Mps1-IN-3
CAS:Mps1-IN-3 is a small molecule that binds to the kinase domain of Mps1 and inhibits its activity. This inhibition leads to cell death by apoptosis, which can be induced by many stimuli including DNA damage. Mps1-IN-3 has been shown to inhibit the mitotic checkpoint in cells in the G1 phase of the cell cycle, leading to cancer therapy. Mps1-IN-3 is a promising drug for inhibiting cancer growth.Formula:C26H31N7O4SPurity:Min. 95%Molecular weight:537.63 g/molGoat anti Human IgG Fc (biotin)
Goat anti-human IgG Fc (biotin) was raised in goat using human igG, Fc fragment as the immunogen.NSMCE1 antibody
NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNCD62L antibody (PE-CY7)
CD62L antibody (PE-CY7) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.
Purity:Min. 95%AQP1 antibody
The AQP1 antibody is a highly specialized monoclonal antibody that targets the aquaporin 1 protein. Aquaporin 1 is a transmembrane protein that facilitates the transport of water across cell membranes. This antibody has been extensively studied and shown to have a high affinity for aquaporin 1, making it an excellent tool for research in various fields such as life sciences.Purity:Min. 95%TCF23 antibody
TCF23 antibody was raised in rabbit using the C terminal of TCF23 as the immunogenPurity:Min. 95%AMG PERK 44
CAS:AMG PERK 44 is a cytosolic calcium ionophore that activates the phosphorylation of eukaryotic protein kinase C. It acts through a biomimetic mechanism to increase Ca2+ concentrations in cells, which leads to increased protein synthesis, autophagy, and cell death. AMG PERK 44 has been shown to be effective against cancer cells and HIV-infected lymphocytes. It has also been shown to inhibit the growth of human immunodeficiency virus (HIV) infected cells by targeting the endoplasmic reticulum and increasing the levels of cytoplasmic Ca2+.
Formula:C34H29ClN4O2Purity:Min. 95%Molecular weight:561.1 g/molAcyl 06:0 NBD pe
CAS:Acyl 06:0 NBD Peptides is a research tool for the study of protein interactions, antibody production, cell biology, pharmacology and other life sciences. Acyl 06:0 NBD Peptides is an inhibitor that blocks ion channels and receptors.Formula:C33H56N5O11PPurity:Min. 95%Molecular weight:729.8 g/molUBE2L3 antibody
UBE2L3 antibody was raised using the middle region of UBE2L3 corresponding to a region with amino acids WQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQNR4A3 antibody
NR4A3 antibody was raised using the middle region of NR4A3 corresponding to a region with amino acids KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN
SUZ12 antibody
SUZ12 antibody was raised in rabbit using the C terminal of SUZ12 as the immunogenPurity:Min. 95%LCOR antibody
LCOR antibody was raised in rabbit using the C terminal of LCOR as the immunogenPurity:Min. 95%NGAL antibody
The NGAL antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is commonly employed in transfer reactions and immunoassays to detect and quantify NGAL (neutrophil gelatinase-associated lipocalin) levels in various biological samples. This antibody has also been investigated as a potential therapeutic agent, particularly as an anti-CD25 antibody drug for targeted therapy.(Mebpi)2ni
CAS:Mebpi2ni is a peptide ligand that binds to the human receptor for amyloid beta-protein. It is a research tool for cell biology, pharmacology, and life science. Mebpi2ni is an inhibitor of ion channels such as voltage-gated sodium channels, transient receptor potential channels, and potassium channels. The CAS number for Mebpi2ni is 78065-33-5. Mebpi2ni has a purity of greater than 98% (HPLC).Formula:C40H32N10NiPurity:Min. 95%Molecular weight:711.44 g/molFZD10 antibody
FZD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFPurity:Min. 95%
