Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
eNOS antibody
eNOS antibody was raised in Mouse using a purified recombinant fragment of human eNOS expressed in E. coli as the immunogen.UCHL1 antibody
UCHL1 antibody was raised in rabbit using the C terminal of UCHL1 as the immunogenPurity:Min. 95%FUT1 antibody
FUT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLPPM1A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1A antibody, catalog no. 70R-5788
Purity:Min. 95%Aak1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Aak1 antibody, catalog no. 70R-9305Purity:Min. 95%Rabbit anti Bovine IgG (Texas Red)
Rabbit anti=bovine IgG was raised in rabbit using ovine IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%KIF5C antibody
KIF5C antibody was raised using the N terminal of KIF5C corresponding to a region with amino acids TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ
MEK2 antibody
The MEK2 antibody is a powerful tool used in life sciences research. It is an acidic antibody that has the ability to neutralize interferon, β-catenin, and TGF-beta proteins. This polyclonal antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It is commonly used in cancer research to study the effects of trastuzumab on tumor growth and metastasis. Additionally, this antibody can be used to detect the presence of specific proteins such as hemoglobin, alpha-fetoprotein, collagen, and TGF-β1. With its high specificity and sensitivity, the MEK2 antibody is an essential tool for researchers in the field of life sciences.Purity:Min. 95%RWDD1 antibody
RWDD1 antibody was raised using the middle region of RWDD1 corresponding to a region with amino acids KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ
AMD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AMD1 antibody, catalog no. 70R-2634Purity:Min. 95%GSTM5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM5 antibody, catalog no. 70R-2852Purity:Min. 95%
