Biochemicals and Reagents

The Beta Amyloid antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody is specifically designed to target and bind to beta amyloid, a protein that plays a crucial role in the development and progression of Alzheimer's disease. By binding to beta amyloid, this antibody inhibits its aggregation and promotes its clearance from the brain.

Mouse monoclonal OTUB2 antibody

Mouse monoclonal KCTD14 antibody

PAI1 antibody was raised in rabbit using highly pure recombinant human PAI-1 as the immunogen.

Rabbit polyclonal RPS20 antibody

Clostridium difficile Toxin B protein is a potent protein that plays a crucial role in the pathogenesis of Clostridium difficile infection. It is involved in disrupting the integrity of the intestinal epithelial barrier and causing severe inflammation. The toxin binds to specific receptors on the cell surface, leading to the activation of various signaling pathways and the release of pro-inflammatory cytokines such as interleukin-6.

The EFNB2 antibody is a medicinal product that falls under the category of Life Sciences. It is an antibody that specifically targets and inhibits the activity of EFNB2 protein. This antibody is known as a polyclonal antibody, meaning it is derived from multiple sources and can recognize different epitopes on the target protein. The EFNB2 antibody has been extensively studied and proven to be effective in various research applications within the field of Life Sciences. Its high specificity and affinity make it a valuable tool for scientists and researchers working in this area. With its ability to selectively bind to EFNB2 protein, this antibody opens up new possibilities for understanding its role in biological processes and developing therapeutic interventions.

The Cathepsin G antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It offers exceptional photostability and cytotoxic properties, making it ideal for various research applications. This antibody targets the cycloalkyl group found in growth factors and polymerase enzymes, including EGF-like proteins.

The CD105 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to CD105, also known as endoglin. CD105 is a cell surface glycoprotein that plays a crucial role in angiogenesis and vascular development. This antibody can be used in various immunoassays, including Western blotting, immunohistochemistry, and flow cytometry.

Rabbit polyclonal PGDH3 antibody (FITC)

Purified recombinant CST11 protein (His tag)

The DAP antibody is a highly specialized monoclonal antibody that acts as an inhibitory factor against chemokines. It binds to specific targets, such as annexin A2 and streptavidin, neutralizing their effects on cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.

Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

HIV1 antibody (HTLV3) was raised in goat using human isolate, highly pure HIV1 as the immunogen.

Mouse monoclonal OB Cadherin antibody

Aste1 antibody was raised in rabbit using the middle region of Aste1 as the immunogen

Recombinant Human TGFB3 protein (His tag)

Purified recombinant CFP protein (His tag)