Biochemicals and Reagents

Rabbit polyclonal Seed G27 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of OR2K2 antibody, catalog no. 70R-9866

SLCO3A1 antibody was raised using the middle region of SLCO3A1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL

The MUTYH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the MUTYH protein, which plays a crucial role in DNA repair. This antibody can be used to study the function and expression of MUTYH in various biological processes. Additionally, it has been shown to interact with growth factors, calmodulin, superoxide, steroids, and other antibodies. The MUTYH antibody is highly specific and sensitive, making it a valuable tool for researchers studying DNA repair mechanisms and related pathways. With its ability to detect and quantify MUTYH protein levels, this antibody is an essential component in understanding the intricate workings of cellular processes.

Purified recombinant Human MMP2 Proenzyme protein

A synthetic peptide for use as a blocking control in assays to test for specificity of PEX11A antibody, catalog no. 70R-6611

The Cytochrome P450 2D6 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of cytochrome P450 2D6, an important enzyme involved in drug metabolism. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of cytochrome P450 2D6.

Rabbit polyclonal hnRNP-E1 antibody

The VASP antibody is a highly effective tool used in life sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody specifically targets the vasodilator-stimulated phosphoprotein (VASP), which plays a crucial role in cell signaling pathways. The VASP antibody is widely used in various applications, including immunofluorescence, Western blotting, and immunohistochemistry.

CCDC38 antibody was raised using the N terminal of CCDC38 corresponding to a region with amino acids RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE

KCTD19 antibody was raised using the N terminal of KCTD19 corresponding to a region with amino acids DSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNL

CARTPT antibody was raised in Rabbit using Human CARTPT as the immunogen

Karyopherin Alpha 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI

MYOD1 antibody was raised in Rabbit using Human MYOD1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. It has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

The G3BP1 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to specifically target and bind to G3BP1, an important protein involved in cellular processes. The G3BP1 antibody can be used for various applications, including immunoassays, Western blotting, and immunohistochemistry.

The MLH1 antibody is a highly effective tool in the field of Life Sciences. It is an activated antibody that acts as a family kinase inhibitor, targeting specific proteins involved in cellular processes. This monoclonal antibody specifically binds to MLH1, a protein involved in DNA repair and maintenance of genomic stability.