Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,560 products)
- By Biological Target(101,036 products)
- By Pharmacological Effects(6,953 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
RGS16 antibody
The RGS16 antibody is a highly specialized chemokine that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different applications. This monoclonal antibody specifically targets alpha-fetoprotein, an important protein found in human serum. It has also demonstrated remarkable anti-mesothelin activity, making it a potential therapeutic option for mesothelioma treatment.BVES antibody
BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSPurity:Min. 95%GNMT antibody
The GNMT antibody is a highly specialized monoclonal antibody that targets the growth factor, epidermal growth factor (EGF). It has been developed for use in Life Sciences research and is particularly useful for studying biomolecules and their interactions. The GNMT antibody can be immobilized on various surfaces such as colloidal electrodes or used in assays to detect the presence of EGF in samples like human serum or liver microsomes. This antibody exhibits cytotoxic effects, making it an excellent tool for investigating cellular responses to EGF stimulation. Additionally, the GNMT antibody has shown potential applications in cancer research, as it specifically recognizes alpha-fetoprotein (AFP), a biomarker associated with certain types of tumors. It is important to note that this antibody should be handled with care due to its nephrotoxic properties.
MKRN2 antibody
MKRN2 antibody was raised using the C terminal of MKRN2 corresponding to a region with amino acids ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSCD235a antibody
The CD235a antibody is a neutralizing monoclonal antibody that is used in Life Sciences research. It has been shown to have natriuretic effects and can be used to study amyloid plaque formation in the brain. This antibody specifically targets activated chimeric proteins and can be used in various applications, such as electrode coating for enhanced signal detection. Additionally, the CD235a antibody has cytotoxic properties and can be conjugated with drugs or toxins for targeted therapy. It also binds to tissue transglutaminase and brain natriuretic peptide, making it a valuable tool for studying these proteins in different biological systems.Keratin K18 antibody
Keratin K18 antibody was raised in mouse using Keratin K18 isolated from HeLa cells as the immunogen.SMS antibody
The SMS antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been specifically designed to target and inhibit protease activity, making it an essential component in various research applications. The colloidal polyrotaxane structure of the SMS antibody ensures its stability and efficacy, allowing for accurate and reliable results.
FANCA antibody
FANCA antibody was raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASSIgG2b Kappa Isotype Control antibody (Biotin)
Mouse monoclonal IgG2b Kappa Isotype Control antibody (Biotin)
Purity:Min. 95%TMTC1 antibody
TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids LFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYVPurity:Min. 95%STAT6 antibody
The STAT6 antibody is a highly specialized and potent cytotoxic agent that is used in various scientific research applications. This antibody specifically targets the STAT6 protein, which plays a crucial role in immune response and cellular signaling pathways. By binding to STAT6, this antibody effectively immobilizes the protein and prevents it from interacting with other molecules.
