Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,564 products)
- By Biological Target(101,024 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD40 protein
CD40 protein is a monoclonal antibody that targets the CD40 receptor, which is expressed on various immune cells. This protein plays a crucial role in regulating immune responses and cell communication. By binding to CD40, the antibody stimulates the production of cytokines, such as tumor necrosis factor-alpha (TNF-α), and enhances the activation of immune cells.Purity:Min. 95%TP53 antibody
The TP53 antibody is a cytotoxic antibody commonly used in Life Sciences research. It specifically targets the TP53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The TP53 antibody has been shown to inhibit the activity of epidermal growth factor (EGF) and histidine kinases, leading to a decrease in diacylglycerol production and glycoprotein synthesis.SLC22A13 antibody
SLC22A13 antibody was raised using the N terminal of SLC22A13 corresponding to a region with amino acids FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMPurity:Min. 95%PRPF8 antibody
PRPF8 antibody was raised in mouse using recombinant Human Prp8 Pre- Processing Factor 8 Homolog (Yeast) (Prpf8)PGM1 antibody
PGM1 antibody was raised in rabbit using the middle region of PGM1 as the immunogenPurity:Min. 95%NBS1 antibody
The NBS1 antibody is a powerful tool used in the field of Life Sciences. It acts as a cdk4/6 inhibitor and plays a crucial role in chemotherapy. This antibody is specifically designed to target genotoxic stress and inhibit the activity of NBS1, a key protein involved in DNA damage response and repair.ADRB1 antibody
The ADRB1 antibody is a neutralizing antibody that targets the adrenergic receptor beta-1 (ADRB1). It plays a crucial role in regulating various physiological processes, including heart rate and blood pressure. This antibody specifically binds to the ADRB1 receptor and inhibits its activity, thereby modulating its downstream signaling pathways.PRMT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT2 antibody, catalog no. 70R-2062Purity:Min. 95%RALB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RALB antibody, catalog no. 70R-4028Purity:Min. 95%VPS4A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VPS4A antibody, catalog no. 70R-2879Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%HDAC8 antibody
The HDAC8 antibody is a highly specific monoclonal antibody that targets the histone deacetylase 8 (HDAC8) protein. This antibody has been extensively validated and is widely used in life sciences research. HDAC8 plays a crucial role in regulating gene expression by removing acetyl groups from histones, thereby affecting chromatin structure and gene transcription. The HDAC8 antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence, to study the expression and localization of HDAC8 in different tissues and cell types. It has been shown to specifically bind to HDAC8 without cross-reactivity with other HDAC isoforms or related proteins. This antibody is an essential tool for researchers studying epigenetics, cancer biology, and drug discovery targeting HDACs.
Purity:Min. 95%RHOX11 antibody
RHOX11 antibody was raised in rabbit using the N terminal of RHOX11 as the immunogen
Purity:Min. 95%
