Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ILDR1 antibody
ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV
Purity:Min. 95%IL6 antibody
The IL6 antibody is a powerful cytotoxic agent that targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various diseases. This monoclonal antibody specifically binds to IL-6, neutralizing its activity and preventing its interaction with cell surface receptors. By blocking the IL-6 signaling pathway, this antibody inhibits the production of other inflammatory mediators such as tumor necrosis factor-alpha (TNF-α) and interferons.PPP1R8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R8 antibody, catalog no. 70R-4732
Purity:Min. 95%FLJ30934 antibody
FLJ30934 antibody was raised in rabbit using the middle region of FLJ30934 as the immunogenPurity:Min. 95%CRTC1 antibody
CRTC1 antibody was raised in Mouse using a purified recombinant fragment of human CRTC1 expressed in E. coli as the immunogen.TWEAK Receptor protein
Region of TWEAK protein corresponding to amino acids EQAPGTAPCS RGSSWSADLD KCMDCASCRA RPHSDFCLGC AAAPPAPFRL LWP.Purity:Min. 95%Neuroserpin antibody
Neuroserpin antibody was raised in rabbit using highly pure recombinant human neuroserpin as the immunogen.Purity:Min. 95%LEC antibody
LEC antibody was raised in mouse using highly pure recombinant human LEC as the immunogen.
GOT2 antibody
GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAPurity:Min. 95%EIF4E3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4E3 antibody, catalog no. 70R-5011Purity:Min. 95%ApoER2 antibody
The ApoER2 antibody is a highly specific reagent used in Life Sciences research. It is produced by a hybridoma cell line and targets the ApoER2 molecule. This monoclonal antibody has been extensively tested and validated for its reactivity against dopamine, endogenous protein kinase, inhibitor p21, IL-2 receptor, and other relevant targets.
