Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,755 products)
- By Biological Target(100,260 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
MMP1 antibody
The MMP1 antibody is a highly targeted molecule that plays a crucial role in various biological processes. This activated antibody acts as a neutralizing agent, specifically designed for Life Sciences applications. It has the ability to bind and inhibit the activity of matrix metalloproteinase 1 (MMP-1), an enzyme responsible for breaking down fibrinogen and other extracellular matrix proteins.STAT5A antibody
The STAT5A antibody is a test substance that specifically targets the glycoprotein STAT5A. This antibody is widely used in the field of medicine and life sciences to study the activation and function of STAT5A. It has been shown to be effective in various experimental setups, including Western blotting, immunohistochemistry, and flow cytometry.
Sec14l3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Sec14l3 antibody, catalog no. 70R-9346
Purity:Min. 95%CANX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CANX antibody, catalog no. 70R-9881Purity:Min. 95%EXOSC4 antibody
EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
CDKN2B antibody
CDKN2B antibody was raised in rabbit using the middle region of CDKN2B as the immunogenACCN5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACCN5 antibody, catalog no. 70R-1510Purity:Min. 95%FKHR antibody
FKHR antibody is a growth factor that acts as a protein kinase. This antibody specifically targets FKHR, which is involved in various cellular processes such as cell growth, proliferation, and survival. The effective dose of this monoclonal antibody has been determined through extensive research and testing. FKHR antibody has been shown to have a high affinity for fatty acids and can effectively inhibit the binding of these molecules to their respective receptors. Additionally, this antibody has demonstrated the ability to block the activity of epidermal growth factor and collagen, two key regulators of cell function. Polyclonal antibodies targeting FKHR have also been developed and can be used for diagnostic purposes. These antibodies are colloidal in nature and have shown excellent specificity and sensitivity when used in assays such as immunohistochemistry or ELISA. Furthermore, FKHR antibody has been found to modulate the expression of chemokines and transforming growth factor-beta (TGF-beta), suggesting its potential role in immune regulation and inflammation control.
Purity:Min. 95%CCDC96 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC96 antibody, catalog no. 70R-3730
Purity:Min. 95%LRRC33 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC33 antibody, catalog no. 70R-7519Purity:Min. 95%GluR1 antibody
The GluR1 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the GluR1 receptor, which plays a crucial role in mediating glutamate signaling in the brain. This antibody has been extensively tested and validated for its high specificity and sensitivity.EIF2S1 antibody
EIF2S1 antibody was raised using the C terminal of EIF2S1 corresponding to a region with amino acids RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED
