Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,755 products)
- By Biological Target(100,260 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
CENTB5 antibody
CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGAVDAC3 antibody
VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE
TNRC18 antibody
TNRC18 antibody was raised in rabbit using the N terminal of TNRC18 as the immunogenPurity:Min. 95%GDF15 antibody
The GDF15 antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It is designed to specifically target and neutralize adeno-associated virus (AAV) particles that are associated with endotoxemia. This antibody can be used in various applications, including immunohistochemistry and Western blotting, to detect the presence of GDF15 antigen. Additionally, it has been shown to have a high affinity for TRPV4, a calcium-permeable ion channel that plays a role in various physiological processes. The GDF15 antibody can also be used in combination with other antibodies, such as anti-CD33 antibody, to study the activation of specific signaling pathways or immune responses. With its specificity and versatility, this monoclonal antibody is an essential tool for researchers in the field of Life Sciences.
C20ORF141 antibody
C20ORF141 antibody was raised using the middle region of C20Orf141 corresponding to a region with amino acids HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGCeruloplasmin Light Tryptic Peptide Standard (4nmol)
A Ceruloplasmin Light Tryptic Peptide Standard for use in protein identification and quantitation studies. Ceruloplasmin is a serum ferroxidase key to transporting copper in the blood. It also plays a role in iron metabolism regulation and the pathogenesis of Wilson disease. Furthermore it has been found in elevated levels during inflammation.Purity:Min. 95%1-(4-Chlorophenyl)-3-((4-methylphenyl)sulfonyl)urea
CAS:1-(4-Chlorophenyl)-3-((4-methylphenyl)sulfonyl)urea (L-Ara-C) is an antitumor agent that binds to DNA, forming a covalent bond with the N7 position of guanine. L-Ara-C inhibits the synthesis of nucleic acid and protein. It has been shown to be active against cancer cells in vitro and in vivo, as well as infectious diseases such as HIV. L-Ara-C is also used as a reagent for studying the function of mitochondrial enzymes. The drug is given intravenously or orally to patients with cancer or other diseases who are receiving chemotherapy.Formula:C14H13ClN2O3SPurity:Min. 95%Molecular weight:324.8 g/molApolipoprotein A1 Light Tryptic Peptide Standard (4nmol)
Apolipoprotein A1 light tryptic peptide standard for protein identification and quantitation studies. Apolipoprotein A1 is a structural component of high density lipoprotein (HDL) and is involved in cellular cholesterol homeostasis and reverse cholesterol transport.Purity:Min. 95%Dynamin inhibitory peptide, myristoylated
CAS:Dynamin inhibitory peptide is a high purity, myristoylated peptide that inhibits dynamin. It is a research tool for studying the interactions of Dynamin with other proteins, ion channels, and receptors. The CAS number for this product is 251634-22-7.Formula:C61H107N19O14Purity:Min. 95%Molecular weight:1,330.6 g/molChlorogenic acid-13C6
CAS:Please enquire for more information about Chlorogenic acid-13C6 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C16H18O9Purity:Min. 95%Molecular weight:360.26 g/mol(±)-Cannabichromevarinic acid
CAS:(±)-Cannabichromevarinic acid is an analog of cannabichromene, a cannabinoid found in cannabis plants. It has been shown to have potential anticancer properties by inhibiting tumor growth and inducing apoptosis in cancer cells. This compound has also been found to inhibit kinase activity, which is involved in cell cycle regulation and proliferation. Studies have shown that (±)-Cannabichromevarinic acid can inhibit the growth of human cancer cells and may be a promising medicinal agent for the treatment of various types of cancer. Additionally, this compound has been detected in Chinese urine samples and may have potential as a protein inhibitor for cancer therapy.Formula:C20H26O4Purity:Min. 95%Molecular weight:330.4 g/molRecombinant EBV Capsid Antigen, p18
Please enquire for more information about Recombinant EBV Capsid Antigen, p18 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Rotavirus Antigen
Please enquire for more information about Rotavirus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Parvovirus B19 Antigen, Virus-Like Particles (VP2)
Parvovirus B19 Antigen, Virus-Like Particles (VP2), biologically engineered to mimic the virus’s outer shell, specifically VP2, a major capsid protein of Parvovirus.
Parvovirus is a single-stranded DNA virus that causes erythema infectiosum in children and arthritis-like symptoms in adults. In vulnerable populations such as pregnant women or immunocompromised individuals, it can cause serious complications like anaemia or hydrops fetails.
Parvovirus VP2 VLPs are commonly used as antigens in diagnostic serology assays to detect antibodies against Parvovirus B19 in patient samples. This antigen is also a useful research tools and can be used in vaccine research.Purity:Min. 95%Native HSV Type 2 Antigen
Please enquire for more information about Native HSV Type 2 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Recombinant EBV Early Antigen p138
Please enquire for more information about Recombinant EBV Early Antigen p138 including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%9-[4-[1-(Dimethylamino)propan-2-yl]phenyl]-8-hydroxy-5H-thieno[2,3-c]quinolin-4-one
CAS:9-[4-[1-(Dimethylamino)propan-2-yl]phenyl]-8-hydroxy-5H-thieno[2,3-c]quinolin-4-one is a peptide that is used as a research tool to study ion channels and protein interactions. It has been shown to inhibit the activity of voltage gated sodium channels in rat hippocampal neurons in vitro. 9-[4-[1-(Dimethylamino)propan-2-yl]phenyl]-8-hydroxy-5H-thieno[2,3-c]quinolin-4-one binds to the binding site of the receptor, which is located on the outside surface of cells or inside cell membranes.Formula:C22H22N2O2SPurity:Min. 95%Molecular weight:378.5 g/mol
![9-[4-[1-(Dimethylamino)propan-2-yl]phenyl]-8-hydroxy-5H-thieno[2,3-c]quinolin-4-one](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FNDC54081.webp&w=3840&q=75)