Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,766 products)
- By Biological Target(100,282 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(355 products)
- Plant Biology(6,882 products)
- Secondary Metabolites(14,351 products)
Found 130641 products of "Biochemicals and Reagents"
MTHFD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFD2 antibody, catalog no. 70R-2419Purity:Min. 95%ROCK1 antibody
The ROCK1 antibody is a highly specific monoclonal antibody that targets the protein ROCK1. This protein plays a crucial role in various cellular processes, including cell growth, migration, and proliferation. By inhibiting the activity of ROCK1, this antibody can effectively block the signaling pathway associated with growth factors and histidine kinases.RBPMS antibody
RBPMS antibody was raised using the middle region of RBPMS corresponding to a region with amino acids PASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPCACD antibody
ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids SSQPSPAICSAPATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPHQALTNFRSF9 protein
TNFRSF9 protein is a glycoprotein that is activated by interferon. It plays a crucial role in immune response and inflammation regulation. TNFRSF9 protein is commonly used in life sciences research, particularly in the field of immunology. It can be detected using various techniques such as hybridization or monoclonal antibody staining. TNFRSF9 protein is often conjugated with other proteins or antigens for specific applications. It is supplied as a highly purified form with excipients to ensure stability and activity. Researchers rely on TNFRSF9 protein for its neutralizing properties against chemokines and its ability to modulate immune responses.Purity:Min. 95%Clock antibody
The Clock antibody is a monoclonal antibody that belongs to the field of Life Sciences. It is specifically designed for neuroprotective purposes and is highly effective in targeting and neutralizing the Clock protein. This antibody has been extensively tested and proven to have high affinity and specificity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. The Clock antibody is colloidal gold-conjugated, making it easy to detect with a simple color change reaction. It has also been shown to inhibit the activity of growth factors like endothelial growth factor and glucagon, making it a valuable tool in studying cellular signaling pathways. With its superior performance and reliability, this antibody is an essential component for any research or diagnostic project related to circadian rhythm regulation or clock genes.
GABRG2 antibody
GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR
Rabbit anti Goat IgG (H + L) (Alk Phos)
Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%SLC35F5 antibody
SLC35F5 antibody was raised using the C terminal of SLC35F5 corresponding to a region with amino acids VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI
Calmegin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLGN antibody, catalog no. 70R-1894
Purity:Min. 95%Glutaredoxin2 protein (His tag)
20-164 amino acids: MSAGWLDRAA GAAGAAAAAA SGMESNTSSS LENLATAPVN QIQETISDNC VVIFSKTSCS YCTMAKKLFH DMNVNYKVVE LDLLEYGNQF QDALYKMTGE RTVPRIFVNG TFIGGATDTH RLHKEGKLLP LVHQCYLKKS KRKEFQLEHH HHHHPurity:Min. 95%LIN9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LIN9 antibody, catalog no. 70R-9006Purity:Min. 95%SMAD3 antibody
The SMAD3 antibody is a highly specialized product used in the field of life sciences. It belongs to the group of polyclonal antibodies and is widely recognized for its high specificity and sensitivity. This antibody is commonly used in various assays, including immunohistochemistry, western blotting, and ELISA.
Purity:Min. 95%Alpha 1 Antitrypsin antibody
Alpha 1 Antitrypsin antibody was raised in Mouse using a purified recombinant fragment of human AAT expressed in E. coli as the immunogen.MAPK14 antibody
MAPK14 antibody was raised in rabbit using the C terminal of MAPK14 as the immunogenPurity:Min. 95%
