Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,757 products)
- By Biological Target(100,261 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
HERC6 antibody
HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHESSPL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ESSPL antibody, catalog no. 70R-5488CCDC127 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC127 antibody, catalog no. 70R-4568Purity:Min. 95%PIK3R1 antibody
PIK3R1 antibody was raised in rabbit using the C terminal of PIK3R1 as the immunogenPurity:Min. 95%FUBP3 antibody
FUBP3 antibody was raised in rabbit using the middle region of FUBP3 as the immunogenPurity:Min. 95%GOLGA7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACSL5 antibody, catalog no. 70R-6556Purity:Min. 95%DPY19L1 antibody
DPY19L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSHITHLFENDRHFSHLSTLEREMAFRTEMGLYYSYFKTIVEAPSFLNGVPRTN3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRTN3 antibody, catalog no. 70R-10258Purity:Min. 95%LINGO4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LINGO4 antibody, catalog no. 70R-6498
Purity:Min. 95%
