Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,755 products)
- By Biological Target(100,260 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LYN antibody
LYN antibody was raised in Mouse using a purified recombinant fragment of LYN expressed in E. coli as the immunogen.USP39 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of USP39 antibody, catalog no. 70R-8280
Purity:Min. 95%PDK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.Purity:Min. 95%GSTK1 antibody
GSTK1 antibody was raised using the middle region of GSTK1 corresponding to a region with amino acids NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLCD61 antibody
The CD61 antibody is a highly specialized antibody-drug that belongs to the class of antibodies known as polyclonal antibodies. It is specifically designed to target a specific antigen, known as CD61, which plays a crucial role in various biological processes including chemokine signaling and immune response. This antibody is widely used in research and diagnostic applications such as immunohistochemistry and flow cytometry.
SLC7A11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A11 antibody, catalog no. 70R-6800Purity:Min. 95%SH3BGRL antibody
SH3BGRL antibody was raised using the middle region of SH3BGRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQAMyc antibody
The Myc antibody is a polyclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It is commonly used in life sciences research for applications such as immunoassays, immunohistochemistry, and western blotting. This antibody has high affinity and specificity for EGFR, making it an ideal tool for studying the role of this receptor in various biological processes.Purity:Min. 95%EFCAB3 antibody
EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAOBOX6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OBOX6 antibody, catalog no. 20R-1165Purity:Min. 95%
