Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,622 products)
- By Biological Target(100,423 products)
- By Pharmacological Effects(6,927 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130307 products of "Biochemicals and Reagents"
NF kappaB p65 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
FRK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FRK antibody, catalog no. 70R-5665Purity:Min. 95%DRGX antibody
DRGX antibody was raised in rabbit using the middle region of DRGX as the immunogenPurity:Min. 95%CDC5L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CDC5L antibody, catalog no. 70R-4924Purity:Min. 95%ZFYVE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZFYVE1 antibody, catalog no. 70R-9007Purity:Min. 95%DDC antibody
DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEALDH3B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH3B1 antibody, catalog no. 70R-2992Purity:Min. 95%SDCBP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SDCBP antibody, catalog no. 70R-1718Purity:Min. 95%PIK3R1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PIK3R1 antibody, catalog no. 70R-7897Purity:Min. 95%Bradykinin Receptor B2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BDKRB2 antibody, catalog no. 70R-1662Purity:Min. 95%Cathepsin D antibody
The Cathepsin D antibody is a highly effective and specific monoclonal antibody that targets the active enzyme Cathepsin D. This antibody has been extensively studied in the field of Life Sciences and has shown great potential for various applications. It binds specifically to Cathepsin D, inhibiting its enzymatic activity and preventing it from binding to its receptors.NARF Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NARF antibody, catalog no. 70R-2294
Purity:Min. 95%F8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of F8 antibody, catalog no. 70R-9971Purity:Min. 95%TEX14 antibody
TEX14 antibody was raised in rabbit using the middle region of TEX14 as the immunogenPurity:Min. 95%
