Biochemicals and Reagents

CXCL14 antibody was raised in rabbit using the middle region of CXCL14 as the immunogen

GAR1 antibody was raised in Rabbit using Human GAR1 as the immunogen

ApoBEC3B antibody was raised using the N terminal of APOBEC3B corresponding to a region with amino acids NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW

Purified Rabbit polyclonal USO1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ARR3 antibody, catalog no. 70R-9875

CD18 antibody was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.

AASDHPPT antibody was raised using the C terminal of AASDHPPT corresponding to a region with amino acids SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE

BACE2 antibody was raised using the N terminal of BACE2 corresponding to a region with amino acids PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG

Collagen Type XXV Alpha 1 antibody was raised using the middle region of COL25A1 corresponding to a region with amino acids GERGEAGPPGRGERGEPGAPGPKGKQGESGTRGPKGSKGDRGEKGDSGAQ

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, effectively inhibiting bacterial growth. Extensive research has shown its high efficacy through the use of advanced techniques such as the patch-clamp technique on human erythrocytes.

Mouse monoclonal PDE2A antibody

The alpha beta TcR antibody is a monoclonal antibody that specifically targets the alpha beta T-cell receptor (TcR). This antibody is widely used in Life Sciences research to study T-cell biology and function. It can be used to detect and quantify T-cells expressing the alpha beta TcR, as well as to investigate the interaction between T-cells and their target molecules.

PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPR

The HES1 antibody is a medicinal composition that is designed to inhibit the activity of the HES1 gene in pluripotent stem cells. This antibody specifically targets and binds to the nucleic acids associated with the HES1 gene, preventing its expression and function. By inhibiting HES1, this antibody can regulate the differentiation and self-renewal of pluripotent stem cells, making it a valuable tool in Life Sciences research. The HES1 antibody is a monoclonal antibody, which means it is highly specific and effective in inhibiting the activity of HES1. It acts as an inhibitor, blocking the interaction between HES1 and its inducer molecules, thereby inhibiting the pluripotent stem cell's ability to differentiate into specific cell types. This inhibitor comes in various forms such as tautomers or solvates, allowing for flexibility in experimental design and application. With its potent inhibitory properties, the HES1 antibody is an essential substance for researchers working

Estrogen-Related Receptor Gamma antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML

The Neuroserpin antibody is a polyclonal antibody that has neutralizing properties against the enzyme collagenase. It can be used in various life sciences applications, including ultrasensitive detection and surface modification. The Neuroserpin antibody is specifically designed to bind to and inhibit the protease activity of collagenase. This specific binding allows for accurate and reliable measurement of collagenase levels using techniques such as electrochemical impedance spectroscopy. The use of this antibody on a carbon electrode enables the ultrasensitive detection of collagenase, making it an invaluable tool in research and diagnostic settings. Whether you're studying proteases or developing diagnostic assays, the Neuroserpin antibody offers high specificity and sensitivity for your experiments.

The CKMM antibody is a specific monoclonal antibody that targets creatine kinase MM (CKMM). This antibody has been extensively studied in the field of Life Sciences and has shown great potential in various applications. CKMM is an enzyme involved in energy metabolism, specifically in the conversion of creatine to phosphocreatine, which plays a crucial role in muscle contraction.