Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,693 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(400 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MPO antibody
The MPO antibody is a highly specialized antibody used in Life Sciences research. It is designed to target and neutralize mesothelin, a protein that is often overexpressed in certain types of cancer cells. This antibody has been extensively tested and proven to be effective in detecting and neutralizing mesothelin in various applications. It can be used for the detection of mesothelin in human serum samples, as well as for research purposes such as studying the role of mesothelin in cancer progression and developing targeted therapies. The MPO antibody is available in both monoclonal and polyclonal forms, providing researchers with options depending on their specific needs. With its high specificity and sensitivity, this antibody is an essential tool for any researcher working in the field of cancer biology or therapeutics development.SDF2 antibody
SDF2 antibody was raised using the N terminal of SDF2 corresponding to a region with amino acids KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCSLC30A3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC30A3 antibody, catalog no. 70R-6762
Purity:Min. 95%Mu Opioid Receptor antibody
The Mu Opioid Receptor antibody is a highly specialized monoclonal antibody that targets the nuclear receptor responsible for binding to endogenous opioids. This antibody has been extensively studied and shown to have a wide range of applications in the field of Life Sciences.VSTM2A antibody
VSTM2A antibody was raised using the middle region of VSTM2A corresponding to a region with amino acids AIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQSGARIATSHGLSVLLLVCPurity:Min. 95%HAUSP antibody
HAUSP antibody was raised in Mouse using a purified recombinant fragment of human HAUSP expressed in E. coli as the immunogen.Tryptophan Hydroxylase antibody
The Tryptophan Hydroxylase antibody is a valuable tool for researchers in the field of Life Sciences. It specifically targets and detects the expression of Tryptophan Hydroxylase, an enzyme involved in the synthesis of serotonin. This antibody is highly specific and has been validated for use in various applications, including immunohistochemistry, Western blotting, and ELISA.GRK2 antibody
The GRK2 antibody is a monoclonal antibody that specifically targets and inhibits the activity of G protein-coupled receptor kinase 2 (GRK2). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It has been found to effectively block the interaction between GRK2 and its target receptors, thereby modulating downstream signaling pathways.Rabbit anti Goat IgG (biotin)
Rabbit anti-goat IgG (biotin) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%EGFR antibody
The EGFR antibody is a highly specialized antibody that targets the epidermal growth factor receptor (EGFR). This receptor is activated by various growth factors and plays a crucial role in cell proliferation and differentiation. The EGFR antibody acts as a neutralizing agent, inhibiting the binding of growth factors to the receptor and preventing downstream signaling pathways.
Purity:Min. 95%Rabbit anti Chicken IgG (FITC)
Rabbit anti-chicken IgG (FITC) was raised in rabbit using chicken IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%GGA3 antibody
GGA3 antibody was raised using the N terminal of GGA3 corresponding to a region with amino acids AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL
