Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,556 products)
- By Biological Target(100,854 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(528 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
Connexin 43 antibody
The Connexin 43 antibody is a monoclonal antibody that targets the Connexin 43 protein. This protein plays a crucial role in cell-to-cell communication and is involved in various cellular processes such as hepatocyte growth, thrombocytopenia, and nephrotoxicity. By targeting Connexin 43, this antibody can modulate these processes and potentially offer therapeutic benefits.PPARG antibody
The PPARG antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to PPARG, a protein involved in various cellular processes. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy.Purity:Min. 95%HHEX antibody
HHEX antibody was raised in mouse using recombinant Homeobox, Hematopoietically ExpressedPDSS1 antibody
PDSS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILBapx1 antibody
Bapx1 antibody was raised in rabbit using the N terminal of BAPX1 as the immunogenPurity:Min. 95%RK-33
CAS:RK-33 is a small molecule inhibitor, which is synthesized as a chemical compound. It functions by targeting and inhibiting the activity of DDX3, a DEAD-box RNA helicase, which plays a crucial role in the modulation of RNA biogenesis and translation processes. By interfering with DDX3, RK-33 disrupts processes essential for the proliferation of certain cancer cells, making it a significant focus in cancer research.Formula:C23H20N6O3Purity:Min. 95%Molecular weight:428.44 g/molGPR27 antibody
GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV
Purity:Min. 95%Leptin antibody
Leptin antibody was raised in mouse using highly pure recombinant human leptin as the immunogen.2-((5-Chloropyridin-2-yl)amino)-N-(3,5-difluorophenethyl)acetamide
CAS:2-((5-Chloropyridin-2-yl)amino)-N-(3,5-difluorophenethyl)acetamide is a small molecule that inhibits the ion channels TRPM8 and TRPA1. It is an inhibitor of TRPM8 and has been shown to inhibit the activity of TRPA1 in vitro. It may be used as a research tool for studying protein interactions, receptor pharmacology, peptides, activator ligands, ion channels and ligand binding.
Formula:C15H14ClF2N3OPurity:Min. 95%Molecular weight:325.74 g/molORM-10962
CAS:ORM-10962 is a potent inhibitor of human kinases that has been shown to be effective against a variety of cancer cell lines. It inhibits the activity of several kinases, including quetiapine and somatostatin, which are involved in tumor growth and proliferation. ORM-10962 induces apoptosis in cancer cells by blocking the kinase activity required for cell survival. This analog has been shown to inhibit the growth of Chinese hamster ovary cells in vitro and to reduce tumor size in vivo. ORM-10962 has also been found to inhibit hyaluronan synthesis, which is involved in cancer cell migration and invasion. In addition, ORM-10962 has potential as a biomarker for cancer diagnosis due to its presence in urine samples from cancer patients.Formula:C27H29N3O4Purity:Min. 95%Molecular weight:459.5 g/molBeta actin antibody
The Beta actin antibody is a highly effective neutralizing agent that targets telomerase, an enzyme involved in cell division and aging. This monoclonal antibody has been extensively tested and proven to have exceptional binding affinity towards telomerase, making it an essential tool for researchers in the field of Life Sciences.4-Fluoro-3-(4-hydroxypiperidin-1-yl)sulfonyl-N-(3,4,5-trifluorophenyl)benzamide
CAS:4-Fluoro-3-(4-hydroxypiperidin-1-yl)sulfonyl-N-(3,4,5-trifluorophenyl)benzamide is a small molecule that binds to and inhibits the activity of ion channels. It has an affinity for ligand gated ion channels, like nicotinic acetylcholine receptors (nAChRs) and serotonin type 3 receptors (5HT3). 4-Fluoro-3-(4-hydroxypiperidin-1-yl)sulfonylbenzamide is a research tool used in pharmacology and protein interaction studies. The compound is available at high purity and can be used as an inhibitor in antibody or cell biology experiments.
Formula:C18H16F4N2O4SPurity:Min. 95%Molecular weight:432.4 g/molDS21360717
CAS:DS21360717 is a synthetic compound, classified as a small-molecule inhibitor, which originates from advanced chemical synthesis techniques within pharmaceutical research. Its mode of action involves targeting and modulating specific cellular pathways, often through inhibiting key enzymes or receptors involved in disease processes. This targeted interaction allows for precise modulation of biological reactions, making it a valuable tool in both research and therapeutic settings.
Formula:C21H23N7OPurity:Min. 95%Molecular weight:389.5 g/molKeratin K18 antibody
Keratin K18 antibody was raised in mouse using human keratin preparation as the immunogen.5-Fluoro-2-(1-methyl-1H-pyrrolo(2,3-B)pyridin-5-yl)oxazolo(5,4-B)pyridine
CAS:5-Fluoro-2-(1-methyl-1H-pyrrolo(2,3-B)pyridin-5-yl)oxazolo(5,4-B)pyridine is an antibody that targets the protein Ion channels. It has a high purity and is being used to study the interactions of proteins with other proteins and ions. 5FMOPP has been shown to inhibit the activation of ion channels by binding to them. This antibody is also used as a research tool for studying cell biology and pharmacology.Formula:C14H9FN4OPurity:Min. 95%Molecular weight:268.25 g/mol
