Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
HAPLN4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HAPLN4 antibody, catalog no. 70R-8828Purity:Min. 95%MFAP4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MFAP4 antibody, catalog no. 70R-6069Purity:Min. 95%SLC5A3 antibody
SLC5A3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%LANCL3 antibody
LANCL3 antibody was raised in rabbit using the C terminal of LANCL3 as the immunogenPurity:Min. 95%TPST2 antibody
TPST2 antibody was raised using the middle region of TPST2 corresponding to a region with amino acids KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLPurity:Min. 95%MIP1 β protein (Mouse)
Region of MIP1 beta protein corresponding to amino acids APMGSDPPTS CCFSYTSRQL HRSFVMDYYE TSSLCSKPAV VFLTKRGRQI CANPSEPWVT EYMSDLELN.Purity:Min. 95%Keratin 19 antibody
The Keratin 19 antibody is a specific antibody used in Life Sciences for ultrasensitive detection. It can be utilized in various applications such as electrochemical impedance spectroscopy, polymerase chain reaction (PCR), flow immunoassay, and more. This antibody is designed to target Keratin 19, a protein commonly found in epithelial cells. It has been extensively validated and proven to provide accurate and reliable results.Purity:Min. 95%RBMS3 antibody
RBMS3 antibody was raised using the C terminal of RBMS3 corresponding to a region with amino acids TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKPSTAT5A antibody
The STAT5A antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and neutralizes STAT5A, a protein involved in various cellular processes. This antibody has been extensively studied and proven to have high affinity and specificity for STAT5A.RNF167 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RNF167 antibody, catalog no. 70R-8558Purity:Min. 95%DUSP12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DUSP12 antibody, catalog no. 70R-7952
Purity:Min. 95%GPR17 antibody
The GPR17 antibody is a polyclonal antibody that targets the G protein-coupled receptor 17 (GPR17). This receptor plays a crucial role in various physiological processes, including urokinase plasminogen activator activity and growth factor signaling. The GPR17 antibody can be used in life sciences research to study the expression and function of this receptor in different cell types and tissues.
