Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,572 products)
- By Biological Target(100,755 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(467 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CNDP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CNDP1 antibody, catalog no. 70R-10125
Purity:Min. 95%Fibronectin antibody
The Fibronectin antibody is a highly specialized antibody that specifically targets fibronectin, a protein involved in cell adhesion and tissue repair. This polyclonal antibody is derived from human serum and has been extensively tested for its specificity and efficacy.
MUC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MUC1 antibody, catalog no. 70R-7267Purity:Min. 95%Cathepsin B antibody
The Cathepsin B antibody is a highly specialized monoclonal antibody that is designed to neutralize the activity of Cathepsin B in human serum. This antibody specifically targets and binds to Cathepsin B, preventing its interaction with other molecules such as TGF-beta, albumin, glutamate, dopamine, and growth factors. By blocking the activity of Cathepsin B, this antibody helps regulate cellular processes and maintain homeostasis in the body.LOC339047 antibody
LOC339047 antibody was raised using the middle region of LOC339047 corresponding to a region with amino acids ECLLTPLPPSALPSADDNLKTPAECLLYPLPPSADDNLKTPPECLLTPLPTMPRSS11D antibody
TMPRSS11D antibody was raised using the N terminal of TMPRSS11D corresponding to a region with amino acids RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRADYNLL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DYNLL1 antibody, catalog no. 70R-2617
Purity:Min. 95%Rabbit anti Sheep IgG (H + L) (HRP)
Rabbit anti-sheep IgG (H+L) (HRP) was raised in rabbit using sheep IgG whole molecule as the immunogen.Purity:Min. 95%Rat Pan Macrophages antibody
Rat pan macrophages antibody was raised in mouse using rat peritoneal macrophages as the immunogen.FRK antibody
The FRK antibody is a highly specialized antibody that has anti-thrombotic properties. It works by targeting and neutralizing the interleukin molecules that are responsible for blood clotting. This antibody is particularly effective against autoantibodies, which are antibodies that mistakenly attack healthy cells and tissues in the body. The FRK antibody is an important intermediate in the development of new medicaments and therapies for various diseases. It has been extensively tested and proven to be safe and effective in preclinical studies using adeno-associated virus as a delivery system. Polyclonal Antibodies, such as the FRK antibody, are widely used in Life Sciences research as powerful tools for studying protein function and localization. They can also be used as inhibitors or therapeutic medicines to target specific proteins or pathways in the body. If you're looking for a reliable and high-quality antibody for your research or medical needs, the FRK antibody is an excellent choice.FAM76A antibody
FAM76A antibody was raised using the N terminal of FAM76A corresponding to a region with amino acids MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK
