Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,560 products)
- By Biological Target(101,036 products)
- By Pharmacological Effects(6,953 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RGS19 antibody
RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWPurity:Min. 95%CEA antibody
The CEA antibody is a monoclonal antibody that acts as a family kinase inhibitor. It is used in the field of Life Sciences as an anticoagulant and inhibitory factor. This monoclonal antibody targets autoantibodies and antibodies, specifically dopamine antigen tyrosine. It has been extensively studied and tested using electrodes and interferon in human serum. With its unique properties, the CEA antibody offers promising potential for various applications in research and clinical settings.SEC63 antibody
SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWAPurity:Min. 95%CRYAB antibody
The CRYAB antibody is a highly effective medicine that has been developed to target specific diseases and conditions. This antibody works by inhibiting the activity of certain enzymes and proteins that are involved in the development and progression of these conditions. It has been shown to be particularly effective against vaccine strains of diseases, as well as collagen-related disorders.TST antibody
TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPSynaptotagmin antibody
The Synaptotagmin antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to synaptotagmin, a protein involved in neurotransmitter release at synapses. This antibody works by blocking the binding of synaptotagmin to its receptor proteins, thereby inhibiting synaptic transmission and reducing neuronal activity.Purity:Min. 95%SIGLEC7 antibody
SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLPurity:Min. 95%CYP2A6 antibody
The CYP2A6 antibody is a polyclonal antibody that specifically targets the CYP2A6 protein. This protein is a member of the cytochrome P450 family and plays a crucial role in drug metabolism. The CYP2A6 antibody can be used for various applications, including research on growth factors, antibodies, and cytotoxicity. It has been widely used in studies involving serum albumin protein, monoclonal antibodies, cytotoxic conjugates, basic proteins, and human serum. Additionally, this antibody has shown inhibitory effects on EGF-like glycosylation and can be used in the development of anti-CD20 antibodies and autoantibodies. Its high specificity and affinity make it an excellent tool for studying the function and regulation of the CYP2A6 protein.Purity:Min. 95%E2F2 antibody
E2F2 antibody was raised in mouse using recombinant Human E2F Transcription Factor 2 (E2F2)
