Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,560 products)
- By Biological Target(101,040 products)
- By Pharmacological Effects(6,954 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130639 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ZNF681 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF681 antibody, catalog no. 70R-9109Purity:Min. 95%TNRC6B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TNRC6B antibody, catalog no. 70R-4881Purity:Min. 95%UBE2F antibody
UBE2F antibody was raised in rabbit using the middle region of UBE2F as the immunogenPurity:Min. 95%MAML3 antibody
MAML3 antibody was raised in rabbit using the middle region of MAML3 as the immunogenPurity:Min. 95%LIG4 antibody
LIG4 antibody was raised using the N terminal of LIG4 corresponding to a region with amino acids DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQATG5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATG5 antibody, catalog no. 70R-9664
Purity:Min. 95%
