Biochemicals and Reagents

LDHB antibody was raised using the C terminal of LDHB corresponding to a region with amino acids MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

The SRY antibody is a highly specialized antibody used for various research and diagnostic purposes. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.

Goat anti-rat IgG (H + L) (Fab'2) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.

Purified recombinant MMP2 protein (His tag)

NR2F1 antibody was raised in rabbit using the N terminal of NR2F1 as the immunogen

Serotonin antibody was raised in rabbit using serotonin/ovalbumin as the immunogen.

1,2-Dipalmitoyl-d62-sn-glycero-3-phosphocholine-N,N,N-trimethyl-d9 is a deuterated phospholipid, which is an important tool in biophysical research. This molecule is sourced from the synthetic modification of natural phosphatidylcholine, incorporating deuterium atoms to enhance its utility in specialized studies. The deuterium labeling replaces hydrogen atoms, which significantly reduces background noise and enhances signal clarity in spectroscopic techniques like NMR and neutron scattering.

PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of the bacteria. Extensive research has been conducted on its human activity using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations like hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.

RASSF1 antibody was raised in rabbit using the C terminal of RASSF1 as the immunogen

OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Purified recombinant Human FKBPL protein

GABARAP antibody was raised in rabbit using Residues 15-31 [RSEGEKIRKKYPDRVPV] of the GABARAP protein as the immunogen.

Progesterone is a steroid hormone that acts as a nuclear receptor in the body. It plays a crucial role in various physiological processes, including the menstrual cycle and pregnancy. Progesterone can be measured in blood plasma using immunoassays, such as flow assays, which utilize monoclonal antibodies specific to progesterone. These antibodies bind to progesterone molecules, allowing for accurate measurement of progesterone concentration. Synthetic progesterone analogs have also been developed for use in research and medical applications. Additionally, surface modification techniques can be employed to immobilize monoclonal antibodies on solid supports, enabling the development of robust and sensitive progesterone detection systems. Overall, progesterone is a vital hormone with diverse functions and its measurement is essential in various fields, including Life Sciences and clinical diagnostics.

The TrkA antibody is a highly specialized monoclonal antibody that targets the growth factor receptor TrkA. This receptor plays a crucial role in cell growth, survival, and differentiation. By binding to the virus surface antigen, the TrkA antibody effectively inhibits the activation of this receptor, preventing abnormal cell growth and proliferation.