Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,560 products)
- By Biological Target(101,040 products)
- By Pharmacological Effects(6,954 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130639 products of "Biochemicals and Reagents"
RGS16 antibody
RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
CNPase antibody
The CNPase antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It is specifically designed to target and bind to CNPase, an enzyme that plays a crucial role in the central nervous system. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNPase in human serum samples.
MGC33407 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MGC33407 antibody, catalog no. 70R-4401
Purity:Min. 95%NSC 117079
CAS:NSC 117079 is a small molecule that binds to the influenza virus and inhibits its ability to invade cells. It also inhibits the activity of human endometrial phosphatase and has been shown to have a potential biomarker for cancer. NSC 117079 is an inhibitor of protein synthesis, which is due to its effect on phosphatases in cells. This drug has been shown to inhibit osteoarthritic cartilage degradation by inhibiting the enzyme cathepsin K and has shown efficacy in studies involving mice with meniscus damage. The pharmacokinetic properties of NSC 117079 are not well-known, but it has been found to be stable in vivo.
Formula:C20H15N3O7S2Purity:Min. 95%Molecular weight:473.48 g/molRef: 3D-AVA36363
Discontinued productEPB41 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EPB41 antibody, catalog no. 70R-3846
Purity:Min. 95%CKMB Antibody
The CKMB Antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to target creatine kinase, an enzyme that plays a crucial role in energy metabolism. This antibody is used for immobilization purposes and can be utilized in various research applications.DIRAS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DIRAS1 antibody, catalog no. 70R-5821
Purity:Min. 95%PNN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNN antibody, catalog no. 70R-6054
Purity:Min. 95%Hmx3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Hmx3 antibody, catalog no. 70R-8774
Purity:Min. 95%Mouse VEGF ELISA kit
ELISA kit for the detection of Human VEGF in the research laboratory
Purity:Min. 95%rel-(αR,3S)-α-Phenyl-α-[2-[2-[(tetrahydro-2H-pyran-4-yl)oxy]phenyl]ethyl]-1-azabicyclo[2.2.2]octane-3-methanol
CAS:Rel-(αR,3S)-α-Phenyl-α-[2-[2-[(tetrahydro-2H-pyran-4-yl)oxy]phenyl]ethyl]-1-azabicyclo[2.2.2]octane-3-methanol is a peptide that belongs to the group of activators. It has been used as a research tool in order to study ion channels and protein interactions. This peptide binds to the ligand binding site of a receptor, thereby activating or inhibiting the function of the receptor. Rel-(αR,3S)-α-Phenyl-α-[2-[2-[(tetrahydro-2H-pyran-4-yl)oxy]phenyl]ethyl]-1-azabicyclo[2.2.2]octane 3 methanol is also an inhibitor that inhibits the protein tyrosine phosphat
Formula:C27H35NO3Purity:Min. 95%Molecular weight:421.6 g/molRef: 3D-DHC33947
Discontinued productRAPGEF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAPGEF1 antibody, catalog no. 70R-5717
Purity:Min. 95%LAB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of lab antibody, catalog no. 70R-2191
Purity:Min. 95%RMI1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RMI1 antibody, catalog no. 70R-5555
Purity:Min. 95%N-[(E,2S,3S)-1,3-Dihydroxyoctadec-4-en-2-yl]hexanamide
CAS:N-[(E,2S,3S)-1,3-Dihydroxyoctadec-4-en-2-yl]hexanamide is a synthetic small molecule that binds to the nicotinic acetylcholine receptor (nAChR) and activates it. This compound has been shown to be an agonist of nAChRs in the central nervous system (CNS). It has also been shown to have a high affinity for binding to both alpha4beta2 and alpha7 nAChRs. N-[(E,2S,3S)-1,3-Dihydroxyoctadec-4-en-2-yl]hexanamide has been used as a research tool in pharmacology and protein interactions.Formula:C24H47NO3Purity:Min. 95%Molecular weight:397.6 g/molRef: 3D-PHA89480
Discontinued productGPR81 antibody
The GPR81 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets GPR81, a receptor involved in various cellular processes. This antibody has been extensively validated through cytotoxic assays and transcription-polymerase chain reaction (PCR) experiments.
![rel-(αR,3S)-α-Phenyl-α-[2-[2-[(tetrahydro-2H-pyran-4-yl)oxy]phenyl]ethyl]-1-azabicyclo[2.2.2]octan…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FDHC33947.webp&w=3840&q=75)
![N-[(E,2S,3S)-1,3-Dihydroxyoctadec-4-en-2-yl]hexanamide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPHA89480.webp&w=3840&q=75)
