Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,560 products)
- By Biological Target(101,036 products)
- By Pharmacological Effects(6,953 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
IL13RA2 antibody
IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
Chicken SAA ELISA Kit
Chicken SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in chicken samples.
Purity:Min. 95%17b Estradiol Short Linker-HRP
17b-Estradiol 6 Short linker Conjugate for use in immunoassaysPurity:Min. 95%C9ORF153 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf153 antibody, catalog no. 70R-3503
Purity:Min. 95%XPO5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Xpo5 antibody, catalog no. 70R-8741
Purity:Min. 95%HIST1H1E Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HIST1H1E antibody, catalog no. 70R-2889
Purity:Min. 95%ACAT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACAT1 antibody, catalog no. 70R-2469
Purity:Min. 95%MINK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MINK1 antibody, catalog no. 70R-7944
Purity:Min. 95%PITPNM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PITPNM1 antibody, catalog no. 70R-9888
Purity:Min. 95%1-Deoxyfructosyl-Val-His
CAS:1-Deoxyfructosyl-Val-His (1DFVH) is a research tool that belongs to the group of activators. It has been shown to activate receptors and ion channels, as well as inhibit antibody production. 1DFVH also has an effect on cell biology, which may be due to its ability to interact with proteins in a variety of ways. 1DFVH binds to the receptor by competitive inhibition and activates the receptor by mimicking the natural ligand. This compound has been shown to activate ion channels in cells through the opening of potassium channels, leading to depolarization and increased calcium influx into cells.
Formula:C17H28N4O8Purity:Min. 95%Molecular weight:416.43 g/molCXorf66 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-35F15.2 antibody, catalog no. 70R-6714
Purity:Min. 95%RBBP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBBP7 antibody, catalog no. 70R-2124
Purity:Min. 95%Villin antibody
The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.
beta Amyloid antibody
The beta Amyloid antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the amyloid protein, which is associated with various neurodegenerative disorders such as Alzheimer's disease. This antibody has been extensively tested and validated for use in immunoassays, making it an essential component in research and diagnostic applications.
