Biochemicals and Reagents

FGF23 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets FGF23, a glycosylated protein involved in mineralization regulation. The FGF23 antibody has been developed to neutralize the activity of FGF23, making it an essential tool for researchers studying bone and mineral metabolism. This antibody is produced using advanced techniques, including colloidal gold labeling or microsphere conjugation, ensuring high specificity and sensitivity. Whether used in immunoassays or as a research tool, the FGF23 antibody provides valuable insights into the role of FGF23 and its signaling pathways, including protein kinase and 3-kinase activation.

A synthetic peptide for use as a blocking control in assays to test for specificity of RDH16 antibody, catalog no. 70R-5493

A synthetic peptide for use as a blocking control in assays to test for specificity of PI16 antibody, catalog no. 70R-6245

The MYD88 Blocking Peptide is a highly specialized product in the field of Life Sciences, Peptides, and Biochemicals. This peptide plays a crucial role in inhibiting the TGF-beta pathway, which is involved in various cellular processes such as cell growth, differentiation, and apoptosis. By blocking the activity of MYD88, this peptide effectively neutralizes the effects of TGF-beta and prevents abnormal endothelial growth.

Orexin receptor antagonist 2 is a peptide that binds to orexin receptors. It inhibits the activity of the orexin receptor and has no effect on other receptors. This compound is used as a research tool to study the function of the orexin receptor. Orexin receptor antagonist 2 can be used in conjunction with antibodies to study protein interactions, or with ligands to study ligand-receptor interactions. Applications include ion channels and neurotransmitter receptors.

TAK-448 is a peptide that inhibits the activation of ion channels. It binds to the ligand binding site of ion channels and blocks the passage of ions, thereby inhibiting the function of these proteins. TAK-448 has been shown to inhibit potassium, calcium, and sodium channels in vitro. This inhibitor also has an antagonist effect on GABA-A receptors in vivo. TAK-448 is a reagent for research in cell biology, pharmacology, and other fields. It can be used as a standard tool to study protein interactions or as an activator for receptor studies. TAK-448 is provided at high purity (greater than 99%) with no detectable contaminants.

A synthetic peptide for use as a blocking control in assays to test for specificity of RXRA antibody, catalog no. 70R-1922

The IL13 antibody is a monoclonal antibody that specifically targets IL-13, a cytokine involved in various immune responses and inflammatory processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in fluorescence-activated cell sorting (FACS) experiments. It has a molecular weight suitable for complex formation and can effectively inhibit the activity of IL-13.

A synthetic peptide for use as a blocking control in assays to test for specificity of Mettl4 antibody, catalog no. 70R-8799

Fenbendazole-amine sulfoxide is a research tool that acts as an activator or ligand for receptor. It is a high-purity reagent for use in pharmacology and cell biology research. Fenbendazole-amine sulfoxide is used to study the function of ion channels and receptors, and its effects on antibody production. Fenbendazole-amine sulfoxide has been shown to inhibit the activity of protein interactions, which may be due to its inhibition of peptide binding or protein synthesis.

Affinity purified Rabbit polyclonal CLIC3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TCEAL3 antibody, catalog no. 70R-8977

G3BP antibody was raised using the N terminal Of G3Bp corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE

Rabbit polyclonal UBTD2 antibody

BDP-13176 is a peptide used as a research tool. It binds to the beta-adrenergic receptor and activates it. BDP-13176 is a high purity product with an ionic charge of -1. It has been shown to inhibit the activity of ion channels, such as voltage-gated calcium channels in neuroblastoma cells. This product also inhibits ligand binding to the beta-adrenergic receptor, which may be due to its ability to compete with endogenous ligands for binding site on the receptor. BDP-13176 is a potent activator of the beta-adrenergic receptor, with an EC50 of 6 nM in rat heart cells.

The ALPPL2 antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets ALPPL2, which is an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting ALPPL2 expression in different tissues and cell types.

Isopropyl 2-methyl-6,11-dioxo-6,11-dihydrobenzo[f]pyrido[1,2-a]indole-12-carboxylate is a peptide that is used as a research tool for the activation of ion channels. It can be used to block potassium channels in order to study their role in the regulation of neuronal activity. Isopropyl 2-methyl-6,11-dioxo-6,11-dihydrobenzo[f]pyrido[1,2-a]indole-12-carboxylate binds to the extracellular domain of potassium channel receptors and has been shown to inhibit receptor binding.

DDOST antibody was raised using the N terminal of DDOST corresponding to a region with amino acids SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD

Affinity purified Rabbit polyclonal SEPHS2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GABRB1 antibody, catalog no. 20R-1330