Biochemicals and Reagents

The FABP5 antibody is a highly potent and cytotoxic monoclonal antibody that targets a specific molecule in the body. Antibodies are proteins produced by the immune system to recognize and neutralize foreign substances. This particular antibody has been extensively studied in the field of Life Sciences due to its ability to inhibit the activity of a ubiquitin ligase, which plays a crucial role in cellular processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM176B antibody, catalog no. 70R-8537

A synthetic peptide for use as a blocking control in assays to test for specificity of UNC45A antibody, catalog no. 70R-9380

A synthetic peptide for use as a blocking control in assays to test for specificity of INPP5K antibody, catalog no. 70R-10254

Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS

PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL

GEMIN4 antibody was raised in Rabbit using Human GEMIN4 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PIGT antibody, catalog no. 70R-7466

The DDX4 antibody is a monoclonal antibody that specifically targets the DDX4 cell antigen. This antibody plays a crucial role in various cellular processes, including exocytosis and phosphatase activity. It has been shown to modulate the production of interleukin-6 (IL-6), a key cytokine involved in immune responses. The DDX4 antibody also exhibits high specificity towards antigens such as hemagglutinin, transferrin, and glycosylation markers. In Life Sciences research, this antibody is widely used for nuclear staining and detection of DDX4 expression. Its unique binding properties make it an invaluable tool for studying cellular processes and protein interactions. With its exceptional performance and reliability, the DDX4 antibody is the go-to choice for researchers in the field of immunology and molecular biology.

A synthetic peptide for use as a blocking control in assays to test for specificity of D930005D10RIK antibody, catalog no. 20R-1172

Affinity purified Rabbit polyclonal MAGI2 antibody

The CD56 antibody is a monoclonal antibody that targets the CD56 glycoprotein. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The CD56 antibody specifically binds to CD56, which is expressed on natural killer cells, T cells, and some subsets of B cells. This binding activates protein kinase pathways, leading to cytotoxicity and apoptosis of target cells.

GSR antibody was raised in Rabbit using Human GSR as the immunogen

The NR4A1 antibody is a monoclonal antibody that targets the cholinergic receptor NR4A1. It has been extensively studied in the field of Life Sciences and has shown promising results in various assays. This antibody has been found to be effective in inhibiting the activity of NR4A1, which plays a crucial role in thrombocytopenia and other related conditions. The NR4A1 antibody works by binding to the receptor and blocking its function, leading to a decrease in platelet production. In addition, this antibody has also been used in research studies involving histidine and epidermal growth factor, further highlighting its versatility. With its cytotoxic properties and ability to inhibit choline acetyltransferase, the NR4A1 antibody holds great potential for therapeutic applications. It is available as both a monoclonal and polyclonal antibody, making it suitable for various research needs.

A synthetic peptide for use as a blocking control in assays to test for specificity of HELLS antibody, catalog no. 70R-4647

GIT2 antibody was raised in rabbit using the C terminal of GIT2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of GOSR1 antibody, catalog no. 70R-9802

The LRG1 Blocking Peptide is a highly effective monoclonal antibody that acts as a phosphatase inhibitor in Life Sciences research. This neutralizing peptide is widely used in the field of monoclonal antibodies and has been proven to effectively block the activity of LRG1, a glycoprotein involved in various biological processes.