Biochemicals and Reagents

Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.

A synthetic peptide for use as a blocking control in assays to test for specificity of FRK antibody, catalog no. 70R-5664

A synthetic peptide for use as a blocking control in assays to test for specificity of PAGE4 antibody, catalog no. 70R-4588

RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI

Mouse monoclonal Episialin antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZIC4 antibody, catalog no. 70R-8386

HISPPD1 antibody was raised using the middle region of HISPPD1 corresponding to a region with amino acids SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV

Affinity purified Rabbit polyclonal Radixin antibody

RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI

GYG2 antibody was raised in Rabbit using Human GYG2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RABL4 antibody, catalog no. 70R-5863

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp to determine its human activity. The metabolism of this drug involves various transformations such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. With its potent properties, this drug offers a promising solution for combating tuberculosis.

The AQP4 antibody is a glycoprotein that plays a crucial role in the regulation of water balance in the body. It is an essential component of the cell membrane and facilitates the movement of water molecules across cell membranes. The AQP4 antibody is widely used in life sciences research, particularly in studies related to water transport and homeostasis.

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K5 antibody, catalog no. 70R-5780

RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

Affinity purified Rabbit polyclonal Flightless I antibody