Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,574 products)
- By Biological Target(100,660 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(362 products)
- Plant Biology(6,908 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
C9ORF4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf4 antibody, catalog no. 70R-6869
Purity:Min. 95%SULT2B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SULT2B1 antibody, catalog no. 70R-2606
Purity:Min. 95%ALDH3A1 antibody
The ALDH3A1 antibody is a powerful tool in the field of antiviral research. It belongs to the class of Monoclonal Antibodies, which are highly specific and effective in targeting specific antigens. This antibody has been extensively studied for its ability to neutralize autoantibodies and antibodies that can cause autoimmune diseases. It has also shown promising results in combination with gemcitabine treatment, enhancing the effectiveness of this chemotherapy drug.FXYD7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FXYD7 antibody, catalog no. 70R-5161
Purity:Min. 95%Neurexophilin 4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NXPH4 antibody, catalog no. 70R-4049
Purity:Min. 95%C11ORF65 antibody
C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI
Gnpda1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Gnpda1 antibody, catalog no. 70R-8786
Purity:Min. 95%PUS10 antibody
PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN
EED antibody
The EED antibody is a highly specialized and potent anti-mesothelin antibody that is widely used in Life Sciences research. It has the ability to bind specifically to mesothelin, a protein that is involved in cell growth and signaling pathways. This antibody is commonly used in studies related to growth factors, chemokines, and other important biological processes. Additionally, the EED antibody has been shown to have neutralizing properties against mesothelin, making it an ideal tool for studying the effects of this protein in various experimental settings. It can be used in a variety of applications including immunohistochemistry, Western blotting, ELISA, and more. With its high specificity and affinity for mesothelin, the EED antibody provides researchers with a valuable tool for understanding the role of this protein in disease development and progression.
Cellubrevin protein
1-77 amino acids: MSTGPTAATG SNRRLQQTQN QVDEVVDIMR VNVDKVLERD QKLSELDDRA DALQAGASQF ETSAAKLKRK YWWKNCK
Purity:Min. 95%Urgcp Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Urgcp antibody, catalog no. 70R-9383
Purity:Min. 95%PF4V1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PF4V1 antibody, catalog no. 70R-5912
Purity:Min. 95%
