Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,620 products)
- By Biological Target(100,451 products)
- By Pharmacological Effects(6,928 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,363 products)
Found 130328 products of "Biochemicals and Reagents"
KGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formula:C114H174N30O42SMolecular weight:2,668.90 g/molTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formula:C48H86N18O16Molecular weight:1,171.33 g/mol(Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt
CAS:Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C388H588N106O114S4Purity:Min. 95%Molecular weight:8,689.73 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SMolecular weight:4,271.67 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formula:C49H81N21O17Molecular weight:1,236.32 g/molbeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Formula:C133H204N34O37SMolecular weight:2,903.38 g/molGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Formula:C194H318N62O62SMolecular weight:4,543.14 g/molPerfluorophenyl 19-(2,5-dioxo-2H-pyrrol-1(5H)-yl)-17-oxo-4,7,10,13-tetraoxa-16-azanonadecan-1-oate
CAS:Perfluorophenyl 19-(2,5-dioxo-2H-pyrrol-1(5H)-yl)-17-oxo-4,7,10,13-tetraoxa-16-azanonadecan-1-oate is a synthetic compound, which is derived through a series of complex organic syntheses involving perfluorinated reagents. This compound is meticulously designed to incorporate both perfluorinated aromatic groups and a flexible, polyether-based linker. The mode of action for this compound primarily revolves around its unique chemical structure, which facilitates interactions at the molecular level that can be favorable for a variety of biochemical applications.
Formula:C24H27F5N2O9Purity:Min. 95%Molecular weight:582.5 g/mol[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Formula:C167H258N46O48SMolecular weight:3,710.26 g/mol[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Formula:C25H37N5O7Molecular weight:519.6 g/molBiotin-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N17O13SMolecular weight:1,286.53 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H32N4O4Purity:Min. 95%Color and Shape:PowderMolecular weight:392.49 g/molα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Formula:C18H33N5O4Molecular weight:383.49 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
ICG 001
CAS:Inhibits interaction between CREB binding protein (CBP) and Wnt/β-catenin
Formula:C33H32N4O4Purity:Min. 95%Molecular weight:548.63 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C23H33N5O9Molecular weight:523.55 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formula:C116H161N27O32S4Molecular weight:2,573.99 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Formula:C34H50N8O6SMolecular weight:698.9 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formula:C61H108N25O22PMolecular weight:1,574.69 g/mol
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
