Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130563 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
| Brand | Product data | Purity | Price range | Estimated delivery |
|---|---|---|---|---|
 | Boc-Phe-Gly-Gly-OH REF: 3D-FB111238 CAS: 103340-16-5 | Min. 95% | 162,00€ ∼ 841,00€ | Discontinued product |
| Brevinin-1 REF: 3D-VAC-00392 | - - - | 319,00€ ∼ 1.190,00€ | Discontinued product |
| Cecropin A (1-7)-Melittin A (2-9) amide REF: 3D-VAC-00558 | - - - | 182,00€ ∼ 651,00€ | Discontinued product |
| Biotin-[Tyr0]-Orexin B, mouse, rat REF: 3D-VAC-00130 | - - - | 330,00€ ∼ 1.229,00€ | Discontinued product |
| Amyloid Bri Protein (1-34) REF: 3D-VAC-00168 | - - - | 386,00€ ∼ 976,00€ | Discontinued product |
| 2A/2B Dengue Protease Substrate REF: 3D-VAC-00048 | - - - | 207,00€ ∼ 740,00€ | Discontinued product |
| TNF-α(71-82), human REF: 3D-VAC-00735 | - - - | 351,00€ ∼ 925,00€ | Discontinued product |
| H-9 hydrochloride REF: 3D-FA17738 CAS: 116970-50-4 | Min. 95% | To inquire | Discontinued product |
| H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH REF: 3D-PP47266 | - - - | 917,00€ ∼ 2.346,00€ | Discontinued product |
| H-Asp-NH2 REF: 3D-FA107876 CAS: 28057-52-5 | Min. 95% | 124,00€ ∼ 921,00€ | Discontinued product |
| Tryptophan Motif Peptide REF: 3D-VAC-00424 | - - - | 202,00€ ∼ 562,00€ | Discontinued product |
| Boc-D-Glu-OEt·DCHA REF: 3D-FB111281 CAS: 449171-15-7 | Min. 95% | 215,00€ ∼ 1.600,00€ | Discontinued product |
| BCIP dipotassium REF: 3D-EB110885 CAS: 102185-49-9 | Min. 98 Area-% | 268,00€ ∼ 1.332,00€ | Discontinued product |
| Boc-D-His(Boc)-OH benzene solvate REF: 3D-FB111250 CAS: 75498-93-0 | Min. 95% | 209,00€ ∼ 1.060,00€ | Discontinued product |
| Tachykinin (111-129) Beta-Prepro (Human) REF: 3D-VAC-00234 | - - - | 188,00€ ∼ 743,00€ | Discontinued product |
| Prolactin Releasing Peptide (12-31), bovine REF: 3D-VAC-00767 | - - - | 206,00€ ∼ 813,00€ | Discontinued product |
| AKT/PKB/Rac-Protein Kinase Substrate REF: 3D-VAC-00251 | - - - | 389,00€ ∼ 1.031,00€ | Discontinued product |
| Boc-Lys(Tfa)-AMC REF: 3D-FB110609 CAS: 97885-44-4 | Min. 95% | 137,00€ ∼ 778,00€ | Discontinued product |
| [Met5,Arg6,7,Val8,Gly9] Enkephalin REF: 3D-VAC-00877 | - - - | 266,00€ ∼ 740,00€ | Discontinued product |
| Z-Ile-Val-OH REF: 3D-FI111494 CAS: 41487-00-7 | Min. 95% | 235,00€ ∼ 2.059,00€ | Discontinued product |