Carboxylic Acids

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ethyl 2-((tert-butoxycarbonylamino)methyl)thiazole-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fibronectin Adhesion-Promoting Peptide trifluoroacetate salt H-Trp-Gln-Pro-Pro-Arg-Ala-Arg-Ile-OH trifluoroacetate salt (FAP) is a synthetic peptide that promotes fibronectin adhesion. It binds to the amino acid sequence in the C terminal end of fibronectin, which is known to be responsible for binding to actin filaments and growth factors. FAP has been shown to promote wound healing by stimulating the proliferation of corneal epithelial cells in vitro. The mechanism of action of FAP may be due to its ability to bind to chloride ions, which are involved in the regulation of cell proliferation and migration.</p>

<p>Osteocalcin is a protein that is synthesized by osteoblasts and released into the extracellular matrix. It is involved in the regulation of bone metabolism, including the synthesis and mineralization of bone matrix. Osteocalcin has been shown to be a marker for osteoarthritis, which may be due to its role in cartilage degradation. This protein has also been implicated in prognosis and diagnosis of this condition. Osteocalcin can be used as a marker for monitoring disease-modifying therapies such as chondroitin sulfate or cross-linking agents.</p>

<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>

<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>a-(Trichloromethyl)benzyl acetate is an organic compound with the formula CHClCOCH. It is a colorless liquid which is soluble in organic solvents. This compound exhibits oxidative carbonylation activity, and has been shown to be used for the coating of particles, detergent compositions, and analytical methods. The microcapsules are prepared by encapsulating a fatty acid in a glycol ether. The health effects of this compound are not well understood but it is believed that it may have some carcinogenic properties.</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>

<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>

<p>Please enquire for more information about Myristoyl-(Lys12·27·28)-VIP-Gly-Gly-Thr (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>

<p>Please enquire for more information about Mating Factor a trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chloromethyl acetate is a potent antibacterial agent that inhibits the growth of bacteria by inhibiting the synthesis of fatty acids. It also has an inhibitory effect on adenosine receptors and is used to treat congestive heart failure, inflammatory diseases, metabolic disorders, and other conditions. Chloromethyl acetate has been shown to be effective against a number of bacterial strains, including methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumoniae, and Mycobacterium tuberculosis. Chloromethyl acetate binds to the cyanoformate group in the bacterial cell wall by competitive inhibition. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme fatty acid synthase that is required for fatty acid biosynthesis, inhibiting protein synthesis and cell division.</p>

<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>

<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dodecylbenzenesulfonic acid is a sulfonic acid that is used in the production of polyaniline. It is also used as an organic reagent that can be applied in organic synthesis, including polymerization and electrochemical studies. Dodecylbenzenesulfonic acid has been shown to react with sodium salts to form dodecyl benzene, which can be observed by synchronous fluorescence spectroscopy. This chemical has a phase transition temperature of -9°C and a boiling point of 176°C. Dodecylbenzenesulfonic acid is soluble in water vapor, but insoluble in ethanol or acetone.</p>

<p>Please enquire for more information about (Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Androstanolone acetate is a synthetic androgen that has been shown to stimulate the production of testosterone in the testes. Androstanolone acetate has been shown to be effective in treating symptoms of male hypogonadism, as well as erectile dysfunction. The drug also has an antigenic effect, which stimulates the production of antibodies against it. Androstanolone acetate binds to cell specific antigens and stimulates cell proliferation. It has been used in cancer prevention studies, where it was found that it could suppress estrogen-induced endometrial cancer in animals. In addition, Androstanolone acetate is capable of stimulating light emission when incubated with cells and can be detected using chromatographic methods.</p>

<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br&gt;br&gt;<br>Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylam</p>

<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>

<p>The H-Gly-Gly-Lys-Arg-OH acetate salt is a diagnostic agent that belongs to the group of active analogues. It is an analogue of sialin, a compound that has been shown to be involved in the molecular pathogenesis of cancer tissues. Sialic acid is an important component of many glycoproteins and glycolipids found in the human body. This compound is metabolized by sialidase enzymes, which are present in various tissues and organs such as the brain, kidney, liver, and plasma. The H-Gly-Gly-Lys-Arg-OH acetate salt inhibits these enzymes by binding to them and preventing their action. This drug also inhibits ATP dependent transport systems for neuronal cells.</p>

<p>4-Pyridinylboronic acid is a boron compound that contains two nitrogen atoms. It is an important reagent in organic synthesis and crystallography. 4-Pyridinylboronic acid has been shown to have biological properties, such as hydrogen bonding interactions. It is also used in the suzuki coupling reaction and the photochemical properties of the reaction solution are dependent on its coordination geometry. 4-pyridinylboronic acid has a high pH value, so it must be prepared in anhydrous sodium carbonate before use. The hydrogen bond between 4-pyridinylboronic acid and an azide is shown below: Nnowiki&gt;/nowiki&gt;Hnowiki&gt;/nowiki&gt;nowiki&gt;/nowiki&gt;Nnowiki&gt;/nowiki&gt;nowiki&gt;/nowiki&gt;H</p>

<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>

<p>Please enquire for more information about (Asp56)-pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydroxy-4-(methylthio)butanoic acid (2HMB) is an amide that is used as a microbial metabolism inhibitor, especially for the inhibition of bacterial growth. 2HMB and its analogues are also used in plant physiology. 2HMB has been shown to have transport properties and can be used as an inorganic acid for the manufacture of hydrochloric acid. It has been found to have enzyme activities, such as polymerase chain reaction and hydroxyl group transferases, which make it a useful catalyst for reactions involving organic compounds. The hydroxyl group in 2HMB makes it a good candidate for use in fatty acid synthesis and oxidation reactions. Chronic exposure to this chemical may lead to carbonyl oxygen formation.</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>

<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>

<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethylenediaminetetraacetic acid tripotassium salt dihydrate is an anticoagulant that can be used as a coagulant for blood samples. It is often used in polymerase chain reactions to synthesize DNA, or to isolate and purify genomic DNA. This compound has ferroelectric properties and can be used as a target cell in optical imaging applications. Ethylenediaminetetraacetic acid tripotassium salt dihydrate is also used in the production of polyurethanes and as a polymerization inhibitor in cinnamon oil.</p>

<p>Trifluoroacetate salt</p>

<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>

<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>

<p>16-Hydroxyhexadecanoic acid is a fatty acid that contains 16 carbons and 2 hydroxyl groups. It can be found in rat liver microsomes, where it binds to the cytochrome P450 enzyme, inhibiting its activity. The structural analysis of this compound has been shown to have intermolecular hydrogen bonding between the nitrogen atoms and the oxygen atoms in the hydroxyl group. 16-Hydroxyhexadecanoic acid also exhibits phase transition temperatures, which are increased by adding water molecules. This compound also has an inhibitory effect on recombinant cytochrome P450 enzymes from p. pastoris and can be used as a substrate for methyl myristate metabolism. In addition, 16-hydroxyhexadecanoic acid binds to dinucleotide phosphate (NADPH) and fluoresces when excited at 340 nm using a fluorescence detector.</p>

<p>Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>

<p>Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.</p>

<p>Please enquire for more information about N-Fmoc-L-gamma-carboxyglutamic acid gamma,gamma-di-t-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>

<p>Please enquire for more information about Pancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.</p>

<p>Undecanoic acid is a fatty acid that belongs to the class of saturated fatty acids. It has been shown to have a number of biological effects, including lowering cholesterol levels, preventing and treating opportunistic fungal infections, and as a contraceptive. Undecanoic acid is also known to increase the body mass index (BMI) in mice and may be useful in the treatment of coronary heart diseases in humans.</p>

<p>Please enquire for more information about Mca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-(D-Dab 4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.</p>

<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt is a potent and selective histidine kinase inhibitor that modulates the activity of many enzymes. TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt has a molecular weight of 476.9 g/mol and chemical formula C12H14N2O4S. The compound was synthesized by reacting tris(2,4,6-trimethoxybenzoyl)amine with pyridoxal 5'-phosphate and histidine in acetic acid. The synthesis reaction yielded a white solid that was then recrystallized from methanol to yield the final product. TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt has been shown to inhibit the enzymatic activity of numerous enzymes at nanomolar concentrations including: protein kinases, phosphatases, ligases</p>

<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>

<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>

<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>

<p>Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>

<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP (4-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Used in treatment of nonspecific ulcerative colitis</p>

<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>

<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>

<p>Please enquire for more information about Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Exendin-4 (1-8) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>

<p>D-Isoascorbic acid is a sodium salt of ascorbic acid. It is used for the prevention and treatment of scurvy, which is caused by vitamin C deficiency. D-Isoascorbic acid functions as an electron donor in biochemical reactions and has been shown to have physiological effects. Ascorbic acid (vitamin C) is a water-soluble antioxidant that can react with hydrogen fluoride in vitro to form free radicals that may cause damage to cells. In addition, D-Isoascorbic acid can be used as a model system for the study of ascorbic acid and p-hydroxybenzoic acid. The analytical method for determining these compounds involves electrochemical impedance spectroscopy.</p>

<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>