Carboxylic Acids

<p>4-Hydroxyphenyl acetate is a naturally occurring fatty acid that is found in many plants. It has been isolated from the seeds of Telfairia occidentalis and has been shown to inhibit the growth of bacteria at a pH of 7.5, with an optimal pH of 8.0. 4-Hydroxyphenyl acetate is an activated form of this compound, which means it contains two hydroxyl groups and does not have to be synthesized by enzymes. 4-Hydroxyphenyl acetate inhibits bacterial enzyme activities such as DNA gyrase and RNA polymerase, which are necessary for transcription and replication. The structure analysis of 4-hydroxy phenylacetate was determined using trifluoroacetic acid (TFA) on a wild-type strain of Escherichia coli K12.</p>

<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>

<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>

<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Antiparallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>

<p>Please enquire for more information about Amyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>

<p>H-Gly-His-Arg-Pro-OH acetate salt is a synthetic monoclonal antibody that binds to fibrinogen. It has been used in the production of a model protein and as an anticoagulant. H-Gly-His-Arg-Pro-OH acetate salt has been shown to inhibit the growth of tissue plasminogen activator, which is a growth factor for cells involved in blood clotting. This drug also inhibits the release of acetylcholine from nerve cells, which may be due to its ability to bind to plasma proteins.</p>

<p>Please enquire for more information about Amyloid beta-Protein (25-35) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PYX-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 6-oxo-1,6-dihydropyridazine-3-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-{[5-(Cyclopropylcarbonyl)-1-methyl-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl]carbonyl}piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>

<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>

<p>1-Methyl-1-cyclohexanecarboxylic acid is a fatty acid that is present in the conjugates of natural and synthetic oils. It is an unsaturated fatty acid with a cycloalkane ring structure. The synthesis of 1-methyl-1-cyclohexanecarboxylic acid has been shown to be catalyzed by a carboxylase, which converts acetyl CoA into malonyl CoA. This reaction is irreversible and can be used as the first step in the biosynthesis of fatty acids. 1-Methyl-1-cyclohexanecarboxylic acid has been shown to cause cell death in leukemia cells, as well as inhibit epileptic seizures in rats.</p>

<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>

<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bz-Val-Gly-Arg-AMC is a growth factor that activates the extracellular signal-regulated protein kinase (ERK) pathway. The activation of this pathway results in an increase in cellular proliferation and inhibition of tumor growth. Bz-Val-Gly-Arg-AMC has been shown to activate ERK by interacting with VSMCs, which are cells that act as a structural component of blood vessels and play a role in regulating blood flow. This compound also induces phosphorylation of glycogen synthase kinase 3β and inhibits its activity, leading to increased protein synthesis through glycolysis. Bz-Val-Gly-Arg-AMC can be used as an inhibitor to bortezomib, a proteolytic enzyme that is used to treat cancer.</p>

<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Cortistatin-29 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>

<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuronostatin-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>

<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Naphthenic acid is a metal chelate that is used in synchronous fluorescence spectroscopy. It has been shown to have biodegradation properties and can be used as an indicator for water quality. Naphthenic acid has been found to be a potent inhibitor of corrosion and is often used as an additive to petroleum products, such as gasoline, that are made from crude oil. Naphthenic acid also has acute toxicities and can cause toxicity studies on humans. It is able to inhibit energy metabolism in cells by binding to the mitochondrial membrane, which may be due to its ability to bind with benzalkonium chloride. Naphthenic acid can also be used for analytical methods, such as electrochemical impedance spectroscopy, because it has high sensitivity and specificity.</p>

<p>Please enquire for more information about Enterotoxin STp (E. coli) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Phe2·6,Pro3)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Conjugated linoleic acid (CLA) is a fatty acid found in beef and dairy products. It is a conjugated form of linoleic acid, which means it has two or more double bonds in its chemical structure. CLA may help to regulate energy metabolism by inhibiting the activity of enzymes involved in fat and carbohydrate metabolism. CLA has also been shown to have inhibitory properties against polymerase chain reaction (PCR), an enzyme that copies DNA during cell division. CLA has also been shown to reduce the symptoms of bowel disease, including reducing inflammation and improving insulin sensitivity. CLA may suppress body weight gain and fat accumulation in humans, as well as reduce the development of type 2 diabetes mellitus. In addition, CLA may be effective against infectious diseases such as tuberculosis and HIV/AIDS because it can lower levels of pro-inflammatory cytokines like tumor necrosis factor-α (TNF-α)</p>

<p>Please enquire for more information about M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>(±)7-EpiJasmonic acid is a carotenoid ester that has been found to have biological properties for weed control. It is the methyl ester of jasmonic acid, which is a fatty acid. The compound has been shown to be effective in suppressing plant diseases such as powdery mildew. The chemical transformation of (±)7-epiJasmonic acid can occur through methylation, hydroxylation, or nitro group formation. This process leads to the production of methyl jasmonate and nitrophenol. These compounds have been shown to have fertility effects on lettuce plants by increasing the number of seeds and seedlings produced.</p>

<p>5-Aminopyridine-3-carboxylic acid (5APC) is a structural analog of nicotinic acid that has been shown to have anti-inflammatory effects. 5APC inhibits the production of inflammatory cytokines, such as IL-10 and IL-17, by inhibiting the activation of NFκB and MAPK pathways. This drug also has significant inhibitory activities against dextran sulfate sodium (DSS)-induced acute colitis in experimental models. 5APC is thought to act by interrupting the assembly of p38 mitogen activated protein kinase (MAPK) and nuclear factor kappa B (NFκB) signaling complexes.</p>

<p>Please enquire for more information about Dnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>

<p>Boc-Arg-Val-Arg-Arg-AMC acetate salt is a protease inhibitor that belongs to the group of basic proteins. It inhibits the action of serine proteases, which are enzymes that break down proteins in cells. Boc-Arg-Val-Arg-Arg-AMC acetate salt has been shown to inhibit leishmania and tumor cell growth. It also inhibits cancer cell proliferation and metastasis. The inhibition of these cancer cell lines by Boc-Arg-Val-Arg-Arg-AMC acetate salt may be due to its ability to inhibit protein synthesis, which is vital for tumor cell growth. Boc Arg Val Arg Arg AMC acetate salt also induces apoptosis (cell death) in some cancer cells through the activation of caspase 3, a cysteine protease that plays an important role in apoptosis signaling pathways.</p>

<p>Tetrahydro-3-furoic acid is an organic acid that can be found in the form of its tautomers, alpha-methylene-gamma-butyrolactone and 3-hydroxy-2,4-pentadienoic acid. It is a proapoptotic compound that induces cell death in cancer cells by inhibiting protein synthesis. Tetrahydro-3-furoic acid has been shown to have low expression levels in most tissues, with high levels found in the liver. The mechanism behind this inhibition is not yet known but may be due to the formation of a Schiff base between the amine and the carbonyl group of tetrahydro-3-furoic acid. This reaction mechanism has been proposed as a possible explanation for why tetrahydro-3-furoic acid is more toxic than other furoates such as ethyl-, propyl-, butyl-, and amyl-. Tet</p>

<p>1H-Indazole-5-boronic acid is a potent compound that belongs to the class of indazole compounds. It has been shown to inhibit protein phosphorylation and induce morphological changes in cells. This compound also inhibits the activity of a number of different cellular enzymes, including protein phosphatases, protein kinases, and protein tyrosine phosphatases. 1H-Indazole-5-boronic acid has been shown to be a promising lead compound for the discovery of novel inhibitors of these enzymes.</p>

<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bz-Nle-Lys-Arg-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Lys-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Leu-OH acetate salt is a derivatized amino acid ester that is used for the detection of lysine and leucine. It is used as an analyte in microextraction, with a sensitivity of 0.25 ng/mL, which can be increased to 0.5 ng/mL by derivatization. H-Lys-Leu-OH acetate salt has been used in the detection of acids and bases, particularly carboxylic acids and basic amino acids, respectively.</p>

<p>Please enquire for more information about (2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>

<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cyclopropane-1,1-dicarboxylic acid, methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>

<p>Please enquire for more information about Mca-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Ile-His-Thr-EDANS acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4,4-Difluorocyclohexaneacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (His(1-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>

<p>Orotic acid hydrate is a synthetic compound that is designed to be a growth regulator. Orotic acid hydrate is synthesized by reacting the orotate with pyridoxine hydrochloride, followed by crystallizing the product. Hydrogen bonds form between the water molecules and fatty acids in the crystals of OA hydrate. These hydrogen bonds stabilize the crystal structure and allow for its use as a growth regulator. The stability of this molecule can also be attributed to its ability to form hydrogen bonds with other molecules such as α-tocopherol, calcium carbonate, and synthetic cannabinoids. Orotic acid hydrate has been shown to have an effect on cancer cells because it reacts with daunorubicin in solution and inhibits DNA synthesis, inhibiting cell growth.</p>

<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (R)-methyl pyrrolidine-3-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ethyl 2-((tert-butoxycarbonylamino)methyl)thiazole-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt is a synthetic peptide that was designed to simulate the activity of bradykinin. It has been shown to be effective in the treatment of angina pectoris and as an analgesic. This peptide can also be used in the analysis of carboxypeptidase activity, by adding it to homogenates and measuring the reaction products. Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt can also be used to analyze salivary glands, activated erythrocytes, and silicon wafers. It is particularly useful for examining morphology and nanowires.</p>

<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>

<p>Please enquire for more information about C5a Anaphylatoxin (human) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteogenic growth peptide is a cyclic peptide that has been shown to activate the production of collagen and other proteins in fibroblasts. It has also been found to promote hematopoietic cell proliferation, as well as stimulate growth in cultured cells. Osteogenic growth peptide is an analog of TGF-β1, but it differs by having a tyrosine residue at the 10th position instead of an arginine residue. This difference in amino acid sequence alters the activity of this peptide and produces a new compound with different biological effects.</p>

<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alarin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>