
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Methyl-N,N-diethyldithiocarbamate
CAS:<p>Methyl-N,N-diethyldithiocarbamate is a copper complex that reacts with nitrogen atoms to form a stable chemical species. It has been shown to have cancer-fighting properties and is used in the treatment of liver cancer. Methyl-N,N-diethyldithiocarbamate also acts as an anti-inflammatory agent. The mechanism of action of methyl-N,N-diethyldithiocarbamate is not fully understood, but it has been suggested that this compound binds to p450 enzymes and inhibits their activity. This drug may also inhibit the production of carbon disulphide (CS2) by the liver microsomes and the elimination rate of methyl-N,N-diethyldithiocarbamate from rat livers.</p>Formula:C6H13NS2Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:163.31 g/molGalanin-Like Peptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C292H451N83O84SPurity:Min. 95%Molecular weight:6,500.28 g/molNociceptin (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H100N22O15Purity:Min. 95%Molecular weight:1,381.59 g/molH-Tyr-Tyr-Phe-OH acetate salt
CAS:<p>H-Tyr-Tyr-Phe-OH acetate salt is a reaction product of the matrix-assisted laser desorption ionization (MALDI) technique. It is an analog of tyrosine, with a hydroxyl group substituted for the amino group. The protonation state of this molecule has been determined by the hydration constant and the centroid to be a neutral pH. Using hydrogen bonding, H-Tyr-Tyr-Phe-OH acetate salt binds to the mitochondria in cells, which may lead to a higher rate of reaction.</p>Formula:C27H29N3O6Purity:Min. 95%Molecular weight:491.54 g/molClofibric acid
CAS:<p>Clofibric acid is a growth factor-β1 (GF-β1) that is an agonist of the nuclear receptor PPARα. Clofibric acid has been shown to inhibit the activity of benzalkonium chloride, an enzyme that degrades DNA, and it also inhibits polymerase chain reactions. Clofibric acid is believed to act as a competitive inhibitor of the ryanodine receptor. It has been shown to have anti-inflammatory properties in transfection experiments with human cells and may be used in analytical methods for measuring clofibric acid levels in pharmaceutical products.</p>Formula:C10H11ClO3Purity:Min. 95%Molecular weight:214.65 g/mol(Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H244N48O40S2Purity:Min. 95%Molecular weight:3,496.04 g/molPep-1-cysteamide trifluoroacetate salt
CAS:<p>Please enquire for more information about Pep-1-cysteamide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H202N36O33SPurity:Min. 95%Molecular weight:2,949.39 g/molNuclear Factor NF-KB Inhibitor SN50 trifluoroacetate salt
CAS:<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>Formula:C129H230N36O29SPurity:Min. 95%Molecular weight:2,781.5 g/molpp60 c-src (521-533) (phosphorylated) trifluoroacetate salt
CAS:<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H95N16O28PPurity:Min. 95%Molecular weight:1,543.48 g/mol(Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H203N39O28SPurity:Min. 95%Molecular weight:2,804.33 g/mol3-(3,5-Dimethoxyphenyl)propionic acid methyl ester
CAS:<p>3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is a reagent that is used as a reactant in organic synthesis. It is also useful as a scaffold for the synthesis of heterocycles and other complex compounds. 3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is used in research chemical synthesis and as a versatile building block for the production of fine chemicals. This chemical can be used to create products such as pharmaceuticals, pesticides, and cosmetics.</p>Formula:C12H16O4Purity:Min. 95%Molecular weight:224.25 g/mol2,5-Anhydro-3,4-dideoxy-erythro-hexaric acid - 98%
CAS:<p>The synthesis of 2,5-anhydro-3,4-dideoxy-erythro-hexaric acid (2,5AHDHE) is described in detail. The reaction starts with the condensation of 3,4-dideoxy-erythro-hexose with aldehyde and furfural to give the hemiacetal. The ring opening of this hemiacetal leads to the formation of 2,5AHDHE and furfural. The protonation of 2,5AHDHE leads to proton release and bond cleavage. Furfural is reduced to 5-hydroxymethylfurfural (HMF). HMF is then oxidized to hydroxyl group by H2O2. The hydroxyl group reacts with a second molecule of 2,5AHDHE to form a new molecule of 2,5AHDHE and H2O2. This process can be repeated until</p>Formula:C6H8O5Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:160.12 g/molH-Gly-Gly-Lys-Ala-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N6O6Purity:Min. 95%Molecular weight:402.45 g/mol4,4',4''-Nitrilotribenzoic acid
CAS:<p>4,4',4''-Nitrilotribenzoic acid is a low molecular weight activated compound with a hexane molecule and luminescence properties. This compound has been used in the detection of human pathogens, for example, Salmonella enterica serovar Typhimurium. The uptake of 4,4',4''-nitrilotribenzoic acid by these bacteria has been shown to be due to its peroxidase-like activity. 4,4',4''-Nitrilotribenzoic acid has also been used for the activation of polybenzimidazole and for polymerization reactions in polybenzimidazole films. The time required for polymerization depends on the concentration of 4,4',4''-nitrilotribenzoic acid used.</p>Formula:C21H15NO6Purity:Min. 95%Molecular weight:377.35 g/mol3-Bromopropylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 3-Bromopropylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H18BBrO2Purity:Min. 95%Molecular weight:248.95 g/mol3-Amino-4-fluorobenzoic acid
CAS:<p>3-Amino-4-fluorobenzoic acid is a hydrocarbon that is used as an analgesic. It has been shown to be nontoxic and has analgesic effects in the intestinal tract. 3-Amino-4-fluorobenzoic acid also has radiopaque properties, which makes it useful for diagnosis and treatment of certain types of cancer and other tumors. The analgesic effect of 3-amino-4-fluorobenzoic acid may be due to its ability to act as a competitive antagonist at the N -methyl--aspartate (NMDA) receptor, which is important in pain perception.</p>Formula:C7H6FNO2Purity:Min. 95%Molecular weight:155.13 g/mol2-Bromoethanesulfonic acid sodium
CAS:<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>Formula:C2H4BrNaO3SPurity:Min. 95%Molecular weight:211.01 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25N7O5Purity:Min. 95%Molecular weight:359.38 g/molPyrrole-2-carboxylic acid
CAS:<p>Pyrrole-2-carboxylic acid is a polycyclic aromatic compound that can be found in coal tar. It has been shown to have anti-inflammatory, antiallergic, and antifungal properties. Pyrrole-2-carboxylic acid is produced by the human body as an intermediate in the metabolism of tryptophan. This compound can also be synthesized and used to treat chronic bronchitis, which is caused by excessive mucus production and inflammation of the airways. The reaction mechanism for pyrrole-2-carboxylic acid is similar to that of other drugs that are used in respiratory therapy, such as aminophylline or acetylcysteine.</p>Formula:C5H5NO2Purity:Min. 95%Molecular weight:111.1 g/mol3,4,9,10-Perylenetetracarboxylic diimide
CAS:<p>3,4,9,10-Perylenetetracarboxylic diimide is a model system for studying the mechanism of protonated pyridine. It is a bicyclic heterocycle that contains two phenyl rings and one imide group. The nitrogen atoms in the molecule form hydrogen bonds with other molecules and can be substituted with chlorine or bromine. 3,4,9,10-Perylenetetracarboxylic diimide has been shown to have chemical stability under conditions of hydrochloric acid and heat. This compound also has a high melting point and is not soluble in water. 3,4,9,10-Perylenetetracarboxylic diimide has been used to study the reaction mechanisms of chemical reactions involving light emission. This compound absorbs light at wavelengths longer than 400 nm (e.g., ultraviolet) and emits light at wavelengths shorter than 400 nm (e.g.,</p>Formula:C24H10N2O4Color and Shape:PowderMolecular weight:390.35 g/molDnp-Pro-TNF-α (71-82) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H94N22O21Purity:Min. 95%Molecular weight:1,423.49 g/mol(Des-Thr5)-Glucagon trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H218N42O47SPurity:Min. 95%Molecular weight:3,381.65 g/molC-Peptide (human) trifluoroacetate salt
CAS:<p>C-Peptide is a monoclonal antibody that binds to the β-cell and inhibits insulin release. It has been used in diagnosis of type 1 diabetes mellitus. C-Peptide is a hormone that regulates blood glucose levels by controlling the rate of glucose production in the liver, as well as by inhibiting the breakdown of glycogen in the liver. The C-terminal amino acid sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu -Leu-Gly can be cleaved from the peptide by trifluoroacetic acid to yield free Gln, which can then be detected using mass spectrometry. Growth factors such as IGF1, FGF21, and HGF have been shown to increase C peptide levels in diabetic patients.</p>Formula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/molHexanedioic acid
CAS:<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>Formula:C6H10O4Color and Shape:White Off-White PowderMolecular weight:146.14 g/mol(Ile3)-Pressinoic acid
CAS:<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>Formula:C30H44N8O10S2Purity:Min. 95%Molecular weight:740.85 g/mol1H-Indazole-5-boronic acid
CAS:<p>1H-Indazole-5-boronic acid is a potent compound that belongs to the class of indazole compounds. It has been shown to inhibit protein phosphorylation and induce morphological changes in cells. This compound also inhibits the activity of a number of different cellular enzymes, including protein phosphatases, protein kinases, and protein tyrosine phosphatases. 1H-Indazole-5-boronic acid has been shown to be a promising lead compound for the discovery of novel inhibitors of these enzymes.</p>Formula:C7H7BN2O2Purity:Min. 95%Molecular weight:161.95 g/molH-Arg-Arg-Arg-Arg-OH acetate salt
CAS:<p>Acetate salt</p>Formula:C24H50N16O5Purity:Min. 95%Molecular weight:642.76 g/molH-Arg-Val-OH acetate salt
CAS:<p>H-Arg-Val-OH acetate salt is a recombinant humanized monoclonal antibody that binds to the serine protease, which is an enzyme that cleaves proteins at specific sites. The antibody inhibits the activity of this enzyme and prevents the release of proteins from cells. It has been shown to be clinically relevant in treating heart failure, chronic pulmonary disease, and congenital heart disease. In addition, H-Arg-Val-OH acetate salt inhibits the release of inflammatory molecules like interleukin 6 (IL6) and tumor necrosis factor alpha (TNFα), which are involved in a variety of diseases.</p>Formula:C11H23N5O3Purity:Min. 95%Molecular weight:273.33 g/molSuc-Ala-Phe-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Ala-Phe-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H39N5O8·C2HF3O2Purity:Min. 95%Molecular weight:735.7 g/mol(Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/molMCLV3 trifluoroacetate salt
CAS:<p>Please enquire for more information about MCLV3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H89N19O19Purity:Min. 95%Molecular weight:1,344.43 g/molMca-Amyloid β/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H129N27O28SPurity:Min. 95%Molecular weight:2,033.19 g/mol(D-Phe2·6,Pro3)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Phe2·6,Pro3)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H80N14O13Purity:Min. 95%Molecular weight:1,193.35 g/mol4-Acetyl-piperidine-1-carboxylic acid tert-butyl ester
CAS:<p>4-Acetylpiperidine-1-carboxylic acid tert-butyl ester is a tert-butyl ester of 4-acetylpiperidine. It can be prepared by the reaction of sodium azide with chloroform and tert-butyl alcohol. The resulting product is a white solid that can be used as an intermediate in organic synthesis.</p>Formula:C12H21NO3Purity:Min. 95%Molecular weight:227.3 g/mol2,5-Diaminoterephthalic acid
CAS:<p>2,5-Diaminoterephthalic acid is a synthetic organic compound that is used as a building block for the synthesis of polyamides. It has been shown to have high salt adsorption properties and low detection limits for certain analytes. 2,5-Diaminoterephthalic acid has also been found to have photocatalytic activity and can be used in the treatment of cancer. This chemical reacts with nitro groups on nucleophilic attack to form the carcinogenic nitrosamine. The formation rate of this nitrosamine depends on the presence of methoxy groups and nitrogen atoms in 2,5-diaminoterephthalic acid.</p>Formula:C8H8N2O4Purity:Min. 95%Molecular weight:196.16 g/molWRW4
CAS:<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H65N15O6Purity:Min. 95%Molecular weight:1,104.27 g/molDABCYL-TNF-α-EDANS (-4 to +6) (human) trifluoroacetate salt
CAS:<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>Formula:C70H104N22O18S·C2HF3O2Purity:Min. 95%Color and Shape:Red SolidMolecular weight:1,687.8 g/molTyrosinase (243-251) (human) acetate salt
CAS:<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C44H68N10O18S2Purity:Min. 95%Molecular weight:1,089.2 g/mol(Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H68N10O12S2Purity:Min. 95%Molecular weight:1,089.29 g/molDynorphin A (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H127N25O14Purity:Min. 95%Molecular weight:1,602.97 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H88N14O27Purity:Min. 95%Molecular weight:1,533.5 g/mol4-(Bromomethyl)phenylacetic acid
CAS:<p>4-(Bromomethyl)phenylacetic acid is a potent cancer drug that blocks the activity of hydrogen-bonding interactions. It inhibits the growth of prostate cancer cells, DU145 cells, and other cell lines. The drug has been shown to inhibit the activation of toll-like receptor 4 (TLR4) in primary blood cells from healthy donors. TLR4 is a protein found on the surface of immune cells that senses molecules from bacteria, fungi, parasites, and viruses. This protein plays an important role in triggering anti-inflammatory and pro-inflammatory responses to infection. The drug also inhibits platelet aggregation and lipoprotein lipase activity in vitro.</p>Formula:C9H9BrO2Purity:Min. 95%Color and Shape:SolidMolecular weight:229.07 g/molH-Pro-Phe-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O4Purity:Min. 95%Molecular weight:390.48 g/mol(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid
CAS:<p>(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid is a benzene ring with a carboxylic acid group. It has the ability to modify polylactic acid, polycarbonate, and other polymers. The chain can be modified to include amino groups or antibacterial groups. (S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid also has antibacterial properties and is compatible with polylactic acid, which makes it ideal for use in polymer modifications.</p>Formula:C12H15NO5Purity:Min. 95%Molecular weight:253.25 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N9O12SPurity:Min. 95%Molecular weight:1,028.27 g/molTri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate
CAS:<p>Tri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate (TBA) is a gadolinium chelate that is used as a contrast agent in magnetic resonance imaging. TBA binds to the malignant cells and shows an increase in uptake of the gadolinium contrast agent. TBA has been shown to be effective in the diagnosis of cancerous brain tissue and is also able to detect cancer cells in animals. TBA has shown some efficacy against bacterial infection by binding to the cell membrane and inhibiting protein synthesis. It is also able to act synergistically with antibiotics such as penicillin or ampicillin to kill bacteria more effectively.</p>Formula:C28H52N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:572.73 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H78N16O13Purity:Min. 95%Molecular weight:1,183.32 g/molent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt
CAS:<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H119N15O13Purity:Min. 95%Molecular weight:1,486.88 g/molH-Val-Ala-pNA acetate salt
CAS:<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C188H282N52O59S2Purity:Min. 95%Molecular weight:4,278.7 g/molZ-Gly-Pro-Arg-pNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H34N8O7·C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:642.66 g/molLys-Lys-IRS-1 (891-902) (dephosphorylated) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Lys-Lys-IRS-1 (891-902) (dephosphorylated) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H114N18O22Purity:Min. 95%Molecular weight:1,595.79 g/mol2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid
CAS:<p>Please enquire for more information about 2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4BF4NO2Purity:Min. 95%Molecular weight:208.91 g/molEthyl-2-ethoxy-1-[[(2'-cyanobiphenyl-4-yl) methyl] benzimidazole-7-carboxylate
CAS:<p>Candesartan is a selective angiotensin II receptor antagonist that inhibits the binding of angiotensin II to its receptors, which in turn decreases the activity of angiotensin-converting enzyme. Candesartan cilexetil is an ester prodrug that has been shown to be effective in the treatment of high blood pressure. In the crystalline form, candesartan cilexetil is a white powder with a melting point of 130–135 °C and a solubility in water of >1 g/L. The molecular weight of candesartan cilexetil is 393.8 g/mol and it has a molecular formula C17H21NO2S. The chemical structure consists of two benzimidazole rings coupled together through an ethyl-2-ethoxy linker and attached to a carboxylate group on one end and an amide group on the other</p>Formula:C26H23N3O3Purity:Min. 95%Molecular weight:425.48 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt is a peptide that has been shown to inhibit the growth of tumor cells. It has also been shown to have biological properties in a number of experimental models, including in vitro and in vivo studies. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt inhibits muscle cell proliferation by binding to the extracellular matrix protein collagen type I. This inhibition leads to reduced tissue formation and body growth. This peptide also inhibits the proliferation of cancer cells by blocking the production of growth factor beta 1 (GFβ1).</p>Formula:C25H42N10O11SPurity:Min. 95%Molecular weight:690.73 g/mol(D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H78N14O11Purity:Min. 95%Molecular weight:1,111.3 g/mol3,3'-Dithiodipropionic acid dimethyl ester
CAS:<p>3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.</p>Formula:C8H14O4S2Purity:Min. 97%Color and Shape:Colorless Clear LiquidMolecular weight:238.33 g/molpTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C406H670N122O126S3Purity:Min. 95%Molecular weight:9,372.61 g/moltert-Butyl carbamate
CAS:<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>Formula:C5H11NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:117.15 g/molEndomorphin-2 trifluoroacetate salt
CAS:<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>Formula:C32H37N5O5Purity:Min. 95%Molecular weight:571.67 g/molExendin-4 (1-8) trifluoroacetate salt
CAS:<p>Please enquire for more information about Exendin-4 (1-8) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N11O13Purity:Min. 95%Molecular weight:833.85 g/molH-Arg-Phe-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N6O4Purity:Min. 95%Molecular weight:392.45 g/mol(Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H286N54O56Purity:Min. 95%Molecular weight:4,222.63 g/molTLQP-21 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N40O26Purity:Min. 95%Molecular weight:2,432.75 g/mol(7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C208H308N54O61SPurity:Min. 95%Molecular weight:4,573.06 g/molFmoc-L-glutamic acid γ-methyl ester
CAS:<p>Please enquire for more information about Fmoc-L-glutamic acid gamma-methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H21NO6Purity:Min. 95%Molecular weight:383.39 g/molpTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C108H173N27O35Purity:Min. 95%Molecular weight:2,409.69 g/mol(Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H293N55O50Purity:Min. 95%Molecular weight:4,087.65 g/mol(Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H83N17O13Purity:Min. 95%Molecular weight:1,226.39 g/molH-Lys-Leu-OH acetate salt
CAS:<p>H-Lys-Leu-OH acetate salt is a derivatized amino acid ester that is used for the detection of lysine and leucine. It is used as an analyte in microextraction, with a sensitivity of 0.25 ng/mL, which can be increased to 0.5 ng/mL by derivatization. H-Lys-Leu-OH acetate salt has been used in the detection of acids and bases, particularly carboxylic acids and basic amino acids, respectively.</p>Formula:C12H25N3O3·C2H4O2Purity:Min. 95%Molecular weight:319.4 g/molGambogic acid
CAS:<p>Gambogic acid is a xanthonoid compound, which is a naturally occurring product derived from the resin of Garcinia hanburyi, a tree found in Southeast Asia. It functions primarily through its apoptotic and anti-proliferative effects on cancer cells. Mechanistically, Gambogic acid binds to transferrin receptors, leading to the disruption of cell survival pathways, inhibition of the NF-kB signaling pathway, and induction of apoptosis by activating caspases and influencing mitochondrial pathways.</p>Purity:Min. 95%H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>Formula:C40H58N10O7SPurity:Min. 95%Molecular weight:823.02 g/molMethyl benzofuran-6-carboxylate
CAS:<p>Methyl benzofuran-6-carboxylate is a synthetic retinoid that is a conformationally constrained analogue of retinoic acid, which is one of the most powerful biological molecules. Methyl benzofuran-6-carboxylate has been shown to be an effective anti-inflammatory agent and may be useful in the treatment of inflammatory skin diseases. It also inhibits the production of proinflammatory cytokines and chemokines, such as TNF-α, IL-1β, IL-8, CCL2, CXCL1, and CXCL2. Methyl benzofuran-6-carboxylate binds to specific receptors on cell surfaces to inhibit the production of inflammatory mediators. The drug also has been shown to have antiangiogenic activity. This property may be due to its ability to inhibit the production of vascular endothelial growth factor (VEGF) and other angiogenic factors.</p>Formula:C10H8O3Purity:Min. 95%Molecular weight:176.17 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Molecular weight:555.63Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H285N55O57SPurity:Min. 95%Molecular weight:4,271.69 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/molHydrazine acetate
CAS:Controlled Product<p>Hydrazine acetate is an organic solution that has a glycoconjugate. It is also found in uridine, hydrogen bond and serine protease. Hydrazine acetate has been shown to have a benzyl group and carbonyl group. Hydrazine acetate interacts with trifluoroacetic acid and particle. This drug can be used for the treatment of autoimmune diseases, such as rheumatoid arthritis, and infectious diseases such as HIV/AIDS. Hydrazine acetate has shown high values for growth factor activity, which may be due to its ability to inhibit the enzyme ns3 protease in the synthesis of proinflammatory cytokines.</p>Formula:C2H4O2·H4N2Purity:Min. 95%Color and Shape:White PowderMolecular weight:92.1 g/molMatrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt
CAS:<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H75N9O11·C2HF3O2Purity:Min. 95%Molecular weight:1,080.2 g/molGastrin I (rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C94H128N22O31S2Purity:Min. 95%Molecular weight:2,126.28 g/moltert-Butyl cis-4-hydroxycyclohexylcarbamate
CAS:<p>Tert-butyl cis-4-hydroxycyclohexylcarbamate is a pharmacological agent that has been shown to have anticonvulsant activity. It is a phenytoin amide that has neurotoxic effects and can cause convulsions. Tert-butyl cis-4-hydroxycyclohexylcarbamate binds to the sulfonamide site on the enzyme GABA transaminase, which converts GABA into succinic semialdehyde, thereby inhibiting the synthesis of GABA. This drug also inhibits the production of acetaldehyde from ethanol by preventing oxidation of NADH and NADPH. The tert-butyl cis-4-hydroxycyclohexylcarbamate was found to have an anticonvulsant effect in animals when given intravenously and orally. It also showed a protective effect against electroshock seizures in rats, suggesting an anticonvulsant activity.</p>Formula:C11H21NO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:215.29 g/mol(Tyr1)-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H295N55O51S2Purity:Min. 95%Molecular weight:4,217.84 g/molPyromeconic acid
CAS:<p>Pyromeconic acid is a trifluoroacetic acid derivative that has been shown to have anti-inflammatory properties. Pyromeconic acid has a redox potential of -0.07 V at pH 7 and can act as a reducing agent in biological systems. It has been shown to inhibit the methylation of pueraria lobata and the transferase activity of methionine synthase, which plays a role in the synthesis of proteins. Pyromeconic acid also inhibits the production of sesquiterpene lactones in carthamus tinctorius, which are responsible for its anti-inflammatory effects. It is an acidic chemical that contains a hydroxyl group and coordinates with metals such as copper, zinc, and nickel.</p>Formula:C5H4O3Purity:Min. 95%Color and Shape:Off-White To Light (Or Pale) Yellow SolidMolecular weight:112.08 g/mol2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid
CAS:<p>Please enquire for more information about 2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H7N3O2S2Purity:Min. 95%Color and Shape:PowderMolecular weight:217.27 g/molUrotensin II-Related Peptide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>Formula:C49H64N10O10S2Purity:Min. 95%Molecular weight:1,017.23 g/molAmyloid β-Protein (16-20) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a peptide that is associated with the development of Alzheimer's disease. The Aβ(16-20) trifluoroacetate salt (ATF) has been used in the diagnosis of Alzheimer's disease by fluorescence microscopy. This compound binds to hyaluronic acid and has been used as a coating for optical fibers and other materials, such as coatings for mitochondria for use in live cell imaging. The ATF also interacts with mitochondria and alters mitochondrial membrane potential, which may be due to its ability to displace cardiolipin from the inner mitochondrial membrane. ATF binds to unsymmetrical dimethylarginine (DMA), an endogenous nitric oxide synthase inhibitor, and selectively inhibits only cancer cells that have elevated levels of DMA. ATFP also induces spontaneous apoptosis in human carcinoma cells when bound to these cells via a photoconjugation reaction with bioconjugate chemistry.</p>Formula:C35H52N6O6Purity:Min. 95%Molecular weight:652.82 g/mol3-Amino-4-hydroxybenzoic acid hydrochloride
CAS:<p>3-Amino-4-hydroxybenzoic acid hydrochloride (3ABA) is a crystalline compound with a molecular formula of C6H5NO2. It is an acidic compound that is soluble in water and alcohol, but not in ether. 3ABA has been used as the starting material for the synthesis of many other organic compounds. It can be obtained by reacting phenol with chlorobenzoyl chloride to form the chlorobenzoate salt, which on hydrolysis yields 3ABA. This compound has also been used as a reagent for synthesizing carbon nanotubes. The crystal structure of 3ABA was determined using X-ray diffraction data from crystallographic studies, and it was found to have three independent molecules per unit cell. Diffraction indicated that each molecule is composed of two benzene rings joined by a single bond between carbon atoms 1 and 2 and another bond between carbon atoms 2 and 3.</p>Formula:C7H8ClNO3Purity:Min. 95%Molecular weight:189.6 g/molFibronectin Fragment (1954-1959) trifluoroacetate salt
CAS:<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H63N11O7Purity:Min. 95%Molecular weight:713.91 g/molAc-Leu-Glu-His-Asp-AMC trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>Formula:C33H41N7O11Purity:Min. 95%Molecular weight:711.72 g/molCyclopropane-1,1-dicarboxylic acid, methylester
CAS:<p>Please enquire for more information about Cyclopropane-1,1-dicarboxylic acid, methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:144.13 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/mol3,4,9,10-Perylenetetracarboxylic dianhydride
CAS:<p>3,4,9,10-Perylenetetracarboxylic dianhydride is a dianhydride that is used in the production of polyesters. It has been shown to form herringbone structures when it is heated and forms kinetic energy. The formation of these structures can be induced by laser ablation. 3,4,9,10-Perylenetetracarboxylic dianhydride also has a redox potential that is more positive than most other organic compounds. This compound can undergo intermolecular hydrogen bonding with glycol ethers and copper chloride and can react with nitrogen atoms to produce photocurrent in model systems. 3,4,9,10-Perylenetetracarboxylic dianhydride also has hydroxyl groups that are important for the biosynthesis of fatty acids.</p>Formula:C24H8O6Purity:Min. 95%Color and Shape:Red PowderMolecular weight:392.32 g/moltrans 4-Dimethylaminocrotonic acid HCl
CAS:<p>Intermediate in the synthesis of afatinib</p>Formula:C6H12ClNO2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:165.62 g/mol4,4-Difluorocyclohexaneacetic acid
CAS:<p>Please enquire for more information about 4,4-Difluorocyclohexaneacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H12F2O2Purity:Min. 95%Molecular weight:178.18 g/molGLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt</p>Formula:C186H275N51O59Purity:Min. 95%Molecular weight:4,169.48 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS:<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol2-Pyrimidine-carboxylic acid
CAS:<p>2-Pyrimidine-carboxylic acid is a biologically active molecule that can be found in the human body. It is a derivative of pyrimidine, which belongs to the group of purines. 2-Pyrimidine-carboxylic acid has been shown to inhibit the nicotinic acetylcholine receptor and α7 nicotinic acetylcholine receptor, which are receptors for acetylcholine. This molecule also has antihypertensive activity and has been shown to have therapeutic effects in psychotic disorders. 2-Pyrimidine-carboxylic acid binds to picolinic acid, which is an important intermediate in the metabolism of tryptophan, and hydroxyl group, which is essential for many biological functions. It also reacts with copper ions and forms a complex that is x-ray crystal structure confirmed. This complex may be used as a herbicide resistance inducer or as a chemical species for receptor binding studies or chemical reactions.</p>Formula:C5H4N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:124.1 g/molCyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt is a peptidomimetic that inhibits the growth of tumor cells by inhibiting angiogenesis, which is the formation of new blood vessels. It has been shown to effectively inhibit the proliferation of endothelial cells and decrease tumor vasculature in human ovarian carcinoma. Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt binds to cyclic peptides in the body and prevents them from being broken down by peptidases. This increases their uptake into cancer cells and inhibits angiogenesis, leading to a decrease in tumor size and number.</p>Formula:C28H43N9O7Purity:Min. 95%Molecular weight:617.7 g/mol
