Carboxylic Acids

<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>

<p>Please enquire for more information about Neuronostatin-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lithium acetoacetate is a compound that is used in the treatment of cancer. It is a salt that contains lithium and acetoacetate. Lithium acetoacetate has been shown to be clinically relevant for the treatment of cancer, particularly in patients who have not responded well to other treatments. This drug has also been shown to induce apoptosis in animal cells, which may be due to its ability to produce acid.</p>

<p>Please enquire for more information about H-Gly-Lys-His-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Phe-AMC Trifluoroacetate salt is a synthetic, protease inhibitor that inhibits the activity of serine and cysteine proteases. It binds to the active site of these enzymes and blocks their function. H-Phe-AMC trifluoroacetate salt has been used in food chemistry to hydrolyze proteins, and can be used to measure enzyme activities. This product also has been shown to have biological functions such as the inhibition of molting, physiological function, and the prevention of carcinogenesis.</p>

<p>Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt is synthesized from a tetrapeptide. It has been shown to be neurotrophic and to stimulate the uptake of dopamine. Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt has also been shown to be an analog of the growth factor nerve growth factor (NGF) and have similar effects on muscle tissue.</p>

<p>Ganoderic acid G is a natural compound that has been extracted from the mushroom Ganoderma lucidum. It has been shown to have anticancer, anti-inflammatory, immunomodulatory, and antioxidant properties. Ganoderic acid G inhibits cancer cell proliferation by inhibiting fatty acid synthesis and promoting apoptosis in cancer cells. It also inhibits the production of inflammatory cytokines such as tumor necrosis factor-α (TNF-α). Ganoderic acid G has been found to inhibit the production of reactive oxygen species in human liver cells.</p>

<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>

<p>Please enquire for more information about Ethyl 4-amino-2-mercaptopyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>

<p>Please enquire for more information about BIM-23627 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (25-35) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta-casomorphin (1-3) amide acetate salt (BCMA) is a peptide that belongs to the class of opioid compounds. It is an amino acid and has been shown to be a potent agonist at opioid receptors. BCMA is used in vivo as a tritiated ligand for mapping the distribution of opioid receptors in rat brain. The affinity of BCMA for opioid receptors increases with dose, and its antinociceptive effects are dose-dependent. Beta-casomorphin (1-3) amide acetate salt has also been shown to have affinity for enkephalins, which are naturally occurring peptides that bind to opioid receptors.</p>

<p>Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>

<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>

<p>Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.</p>

<p>Epsilon-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt (EMAP) is a crosslinker that belongs to the group of heterobifunctional reagents. It has been used to conjugate monoclonal antibodies with other molecules, such as toxins. EMAP is activated by the dianion generated by protonation of the nitro groups on the phenyl ring and reacts with free amines or thiols in proteins. EMAP can be used for labeling immunotoxins for diagnostic use, maximizing detection sensitivity, and crosslinking DNA molecules for use in molecular cloning experiments.</p>

<p>Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>

<p>Please enquire for more information about (Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ethyl 2,4-dichloropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>

<p>3,5-Dibromobenzoic acid methyl ester is an organic compound that has isomers. It is a synthetic substance with the chemical formula CHBrO. This substance can be obtained by reacting benzoic acid with bromine in the presence of aluminium chloride. The nature of this substance is not known due to its multifold structure. 3,5-Dibromobenzoic acid methyl ester has been shown to absorb light and transfer it to another molecule. This molecule can then emit light of a different wavelength or energy level. The dipole moment of the substance interacts with other molecules in close proximity, leading to the transfer of electrons and photons from one molecule to another.</p>

<p>Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3,5-Dichloropyrazine-2-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Benzyl-4-((tert-butoxycarbonyl)amino)piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>

<p>Please enquire for more information about RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Cyclohexyl-2-hydroxy-phenylacetic acid is a potent inhibitor of the cholinergic muscarinic receptors. It has been used as an anticholinergic drug and in pharmaceutical preparations for the treatment of inflammatory diseases. 2-Cyclohexyl-2-hydroxy-phenylacetic acid is used to treat urinary incontinence, although it can also cause constipation. Side effects of 2-cyclohexyl-2-hydroxy phenylacetic acid include headache, drowsiness, dry mouth, and blurred vision. 2 CPHPA is an inorganic acid that reacts with phosphorus pentachloride to form an organic phosphate ester called pentachlorophosphoric acid (PCPA). This reaction can be reversed by adding hydrochloric acid. The PCPA salt of 2 CPHPA is called diethylamine salt.</p>

<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>

<p>Please enquire for more information about H-Phe-Met-D-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,4,9,10-Perylenetetracarboxylic dianhydride is a dianhydride that is used in the production of polyesters. It has been shown to form herringbone structures when it is heated and forms kinetic energy. The formation of these structures can be induced by laser ablation. 3,4,9,10-Perylenetetracarboxylic dianhydride also has a redox potential that is more positive than most other organic compounds. This compound can undergo intermolecular hydrogen bonding with glycol ethers and copper chloride and can react with nitrogen atoms to produce photocurrent in model systems. 3,4,9,10-Perylenetetracarboxylic dianhydride also has hydroxyl groups that are important for the biosynthesis of fatty acids.</p>

<p>Please enquire for more information about Tert-butyl 4-(3-hydroxypropyl)tetrahydro-1(2H)-pyridinecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 2-fluoroacetoacetate is a phosphorus oxychloride synthon that can be used to synthesize fluorinated compounds. It has been shown to react with a carbonyl group, like tyrosine, in the presence of an organocatalyst to form a tetrafluoroborate ester. The reaction mechanism of this compound is intramolecular hydrogen transfer from the phosphite oxygen atom to the electrophilic carbon atom. Ethyl 2-fluoroacetoacetate has been shown to react with alkyl halides and hydroxyl groups in the presence of base, forming enantiomeric alcohols. This compound has also been shown to have optical properties that are stable at room temperature and pressure, including infrared absorption maxima at 1740 cm-1 and 1775 cm-1 as well as ultraviolet absorption maxima at 225 nm and 254 nm.</p>

<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about OM99-2trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>

<p>Gambogic acid is a xanthonoid compound, which is a naturally occurring product derived from the resin of Garcinia hanburyi, a tree found in Southeast Asia. It functions primarily through its apoptotic and anti-proliferative effects on cancer cells. Mechanistically, Gambogic acid binds to transferrin receptors, leading to the disruption of cell survival pathways, inhibition of the NF-kB signaling pathway, and induction of apoptosis by activating caspases and influencing mitochondrial pathways.</p>

<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Keto-4-etiocholenic acid is a type of fatty acid that is naturally found in the human body. It is produced by the oxidation of other types of fatty acids and is an intermediate in the synthesis of sex hormones. 3-Keto-4-etiocholenic acid can be synthesized by recombinant methods, which are used to produce proteins for research purposes. It has been shown to have cytostatic effects, which may be due to its irreversible inhibition of enzymes involved in biological function.</p>

<p>Please enquire for more information about 2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ozarelix acetate salt is a synthetic androgen that has been shown to have pharmacological activity in the treatment of prostate cancer. It binds to albumin, which is found in high concentrations in the prostate, and is then released slowly over time. In rat studies, it has been shown to improve symptoms of depression by binding to serotonin receptors. This drug also binds with fatty acids in blood plasma and can be used as a biomarker for the presence of cancer. Ozarelix acetate salt has not been studied extensively in humans, but has shown promising results when used for the treatment of diabetic neuropathy and for cancer prevention.</p>

<p>Please enquire for more information about (D-Ser6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Conjugated linoleic acid (CLA) is a fatty acid found in beef and dairy products. It is a conjugated form of linoleic acid, which means it has two or more double bonds in its chemical structure. CLA may help to regulate energy metabolism by inhibiting the activity of enzymes involved in fat and carbohydrate metabolism. CLA has also been shown to have inhibitory properties against polymerase chain reaction (PCR), an enzyme that copies DNA during cell division. CLA has also been shown to reduce the symptoms of bowel disease, including reducing inflammation and improving insulin sensitivity. CLA may suppress body weight gain and fat accumulation in humans, as well as reduce the development of type 2 diabetes mellitus. In addition, CLA may be effective against infectious diseases such as tuberculosis and HIV/AIDS because it can lower levels of pro-inflammatory cytokines like tumor necrosis factor-α (TNF-α)</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Lys6)-LHRH (free acid) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-DL-Val-Leu-Arg-pNA acetate salt is a natriuretic that is used to treat chronic kidney failure. It has an inhibitory effect on serine protease and epidermal growth factor, which are enzymes involved in the production of atrial natriuretic peptide (ANP). The drug also reduces blood pressure by inhibiting the activity of angiotensin II, which is a potent vasoconstrictor. H-DL-Val-Leu-Arg-pNA acetate salt has been shown to increase urea nitrogen levels by inhibiting the activity of alkaline phosphatase, which breaks down ammonia in the liver.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br&gt;br&gt; Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>

<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>

<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>

<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>

<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>

<p>4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.</p>

<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>

<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Ala-Ala-OMe acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-tert-Butylphenylboronic acid is an aromatic hydrocarbon that belongs to the class of phenoxy. It is a molecule with nitrogen atoms and a molecular weight of 144.17 g/mol. 4-tert-Butylphenylboronic acid has been shown to form a copper complex in the presence of sodium trifluoroacetate, which is used for cross-coupling reactions. This compound also reacts with hydrochloric acid to form 4-methoxyphenylboronic acid and trimethyl boronate, which can be used as reaction products in organic synthesis. The stability of this compound has been studied using electrochemical impedance spectroscopy (EIS) on thin films.</p>