Carboxylic Acids

<p>Please enquire for more information about Amyloid beta-Protein (20-29) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-5-aminopentanoyl-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chloromethyl acetate is a potent antibacterial agent that inhibits the growth of bacteria by inhibiting the synthesis of fatty acids. It also has an inhibitory effect on adenosine receptors and is used to treat congestive heart failure, inflammatory diseases, metabolic disorders, and other conditions. Chloromethyl acetate has been shown to be effective against a number of bacterial strains, including methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumoniae, and Mycobacterium tuberculosis. Chloromethyl acetate binds to the cyanoformate group in the bacterial cell wall by competitive inhibition. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme fatty acid synthase that is required for fatty acid biosynthesis, inhibiting protein synthesis and cell division.</p>

<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Eledoisin acetate salt is a cell-lysing agent that belongs to the group of potent antagonists. It is an inhibitor of neurokinin-1 receptor which regulates the release of substance P and other inflammatory mediators from nerve terminals. Eledoisin acetate salt has shown to inhibit locomotor activity in rats, as well as nucleotide levels in cells. This drug also has been shown to have carcinoid syndrome-like effects, such as weight loss and diarrhea. These symptoms are caused by the inhibition of substance P at its receptors. The tumor necrosis factor (TNF) may be responsible for these effects, since it causes increased production of substance P in cells.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Aminocaproic acid is a non-specific lysing agent that is used in the treatment of acute blood clots. Aminocaproic acid has minimal toxicity and low-dose effects, and can be used for the treatment of thrombotic disorders. It also has biological properties that are different from those of aminocaproate, which can lead to a more rapid dissolution of the clot. Aminocaproic acid is an organic compound that belongs to the class of dicarboxylic acids. It is synthesized from two molecules of aminoacetic acid by the enzyme aminocaproic acid synthetase. The synthesis occurs in a two-step process: first, caprylic acid reacts with ATP to form aminopropyl-adenylate (APA), followed by hydrolysis by APA lyase to form aminocaproic acid.</p>

<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>

<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Val-Leu-Lys-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>

<p>Please enquire for more information about 4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dimethyl benzyl carbinol acetate is a polymer that forms a film on the skin and prevents water loss. It has been shown to have enzyme-inhibiting properties, which may be due to its ability to prevent geranyl production. Dimethyl benzyl carbinol acetate has also been used as a sealant in microcapsules, which are then broken down by enzymes in order to release the contents of the capsule. Dimethyl benzyl carbinol acetate can also be used as an antimicrobial agent, where it inhibits bacterial cell growth by interfering with fatty acid synthesis.</p>

<p>Please enquire for more information about Galacto-RGD trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (4-Chloro-3-fluorophenyl)acetic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethylene glycol monoacetoacetate monomethacrylate is a metal chelate that is used to treat muscle diseases. It has been shown to act as a gamma-aminobutyric acid agonist and inhibit the release of acetylcholine from nerve endings. This drug can also be used as a chemical stabilizer in the synthesis of polymers in organic chemistry. Ethylene glycol monoacetoacetate monomethacrylate is insoluble in water and soluble in organic solvents such as ethanol, acetone, or benzene. It has been found to have a phase transition temperature at -139°C, which is suitable for applications that require low temperatures. Ethylene glycol monoacetoacetate monomethacrylate reacts with sodium carbonate to form an ester and methacrylic acid (MAA). The reaction solution is typically heated with stirring until it reaches 40°C-50°C. The particle size of</p>

<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>7-Hydroxyheptanoic acid is a fatty acid that has the hydroxyl group on the seventh carbon. It is biosynthesized from the hydroxylation of heptanal, which is catalyzed by a monooxygenase. The hydroxyl group in 7-hydroxyheptanoic acid can be oxidized to form a carboxylic acid (e.g., 7-ketoheptanoic acid). 7-hydroxyheptanoic acid can also be used as a coating material because it has functional groups and is biodegradable and metal ion free.</p>

<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>

<p>Please enquire for more information about 1-{[5-(Cyclopropylcarbonyl)-1-methyl-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl]carbonyl}piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Hydroxyphenyl acetate is a naturally occurring fatty acid that is found in many plants. It has been isolated from the seeds of Telfairia occidentalis and has been shown to inhibit the growth of bacteria at a pH of 7.5, with an optimal pH of 8.0. 4-Hydroxyphenyl acetate is an activated form of this compound, which means it contains two hydroxyl groups and does not have to be synthesized by enzymes. 4-Hydroxyphenyl acetate inhibits bacterial enzyme activities such as DNA gyrase and RNA polymerase, which are necessary for transcription and replication. The structure analysis of 4-hydroxy phenylacetate was determined using trifluoroacetic acid (TFA) on a wild-type strain of Escherichia coli K12.</p>

<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid is a benzene ring with a carboxylic acid group. It has the ability to modify polylactic acid, polycarbonate, and other polymers. The chain can be modified to include amino groups or antibacterial groups. (S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid also has antibacterial properties and is compatible with polylactic acid, which makes it ideal for use in polymer modifications.</p>

<p>4-Fluorophenoxyacetic acid is a chemical compound that is used as an insecticide. It has been shown to be effective against the planthopper and ipomoea, two agricultural pests. 4-Fluorophenoxyacetic acid binds to the active site of a specific protein in the insect's cells, inhibiting its function and causing cell death. 4-Fluorophenoxyacetic acid also inhibits the growth of human breast cancer cells in culture. The molecular weight of this compound is 180.2 g/mol and has a melting point of 185°C with a boiling point of 232°C at atmospheric pressure. 4-Fluorophenoxyacetic acid can be synthesized by reacting phenol with acetic anhydride in the presence of palladium complexes and nitrogen atoms. The reaction mechanism for this synthesis is nucleophilic addition to form a covalent bond between the nitrogen atom and sulfur atom on one side of the</p>

<p>Please enquire for more information about Biotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Methoxycarbonylphenylboronic acid is an organic compound that can be synthesized from biphenyl. It is a diazonium salt with a bidentate ligand and a carbonyl group, which allows it to form an intermolecular hydrogen bond. The phenyl group of 4-methoxycarbonylphenylboronic acid can be oxidized to the corresponding carboxylic acid or reduced to the corresponding alcohol.<br>4-Methoxycarbonylphenylboronic acid is also soluble in halides, iodinations, and mercaptoacetic acid. This compound has been used as an acceptor in the oxidation of aluminium with diborane as a catalyst. 4-Methoxycarbonylphenylboronic acid has also been used to synthesize other compounds such as metronidazole (a drug) and erythromycin (an antibiotic).</p>

<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>

<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.</p>

<p>Used in treatment of nonspecific ulcerative colitis</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>