Carboxylic Acids

<p>Please enquire for more information about APL1b27 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.</p>

<p>Please enquire for more information about Sperm Peptide P10G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP (4-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A component of Conus venom; antagonist of nicotinic acetylcholine receptors</p>

<p>3-Acetyl-alpha-boswellic acid is a compound that has been derived from the plant Boswellia serrata. It has been shown to have antiinflammatory properties and may have clinical potential as an agent for the treatment of inflammatory diseases. 3-Acetyl-alpha-boswellic acid was found to inhibit the proliferation of myeloid leukemia cells, which were activated by cytokine stimulation. This compound also decreased the mitochondrial membrane potential in hl-60 cells, inhibited the plasma concentrations of proinflammatory cytokines, and had a two-way crossover study with healthy volunteers. In addition, it inhibits the production of 11-keto-beta-boswellic acid (KBA), which is a metabolite of 3AB that is associated with cancer progression. The antiinflammatory effects of 3AB are due to its ability to inhibit NFκB activation and downregulate IL1β and TNFα expression in leukemic cells.</p>

<p>Boc-Arg-Val-Arg-Arg-AMC acetate salt is a protease inhibitor that belongs to the group of basic proteins. It inhibits the action of serine proteases, which are enzymes that break down proteins in cells. Boc-Arg-Val-Arg-Arg-AMC acetate salt has been shown to inhibit leishmania and tumor cell growth. It also inhibits cancer cell proliferation and metastasis. The inhibition of these cancer cell lines by Boc-Arg-Val-Arg-Arg-AMC acetate salt may be due to its ability to inhibit protein synthesis, which is vital for tumor cell growth. Boc Arg Val Arg Arg AMC acetate salt also induces apoptosis (cell death) in some cancer cells through the activation of caspase 3, a cysteine protease that plays an important role in apoptosis signaling pathways.</p>

<p>Tetrahydro-3-furoic acid is an organic acid that can be found in the form of its tautomers, alpha-methylene-gamma-butyrolactone and 3-hydroxy-2,4-pentadienoic acid. It is a proapoptotic compound that induces cell death in cancer cells by inhibiting protein synthesis. Tetrahydro-3-furoic acid has been shown to have low expression levels in most tissues, with high levels found in the liver. The mechanism behind this inhibition is not yet known but may be due to the formation of a Schiff base between the amine and the carbonyl group of tetrahydro-3-furoic acid. This reaction mechanism has been proposed as a possible explanation for why tetrahydro-3-furoic acid is more toxic than other furoates such as ethyl-, propyl-, butyl-, and amyl-. Tet</p>

<p>1H-Indazole-5-boronic acid is a potent compound that belongs to the class of indazole compounds. It has been shown to inhibit protein phosphorylation and induce morphological changes in cells. This compound also inhibits the activity of a number of different cellular enzymes, including protein phosphatases, protein kinases, and protein tyrosine phosphatases. 1H-Indazole-5-boronic acid has been shown to be a promising lead compound for the discovery of novel inhibitors of these enzymes.</p>

<p>Dithiobis(3-mercaptopropionate) is an analog of 3-[(2-Aminoethyl)dithio]propionic acid (DTA). It has been used as a cross-linking agent for the synthesis of polymers with acidic pH. Dithiobis(3-mercaptopropionate) is also used for the synthesis of conjugates and bifunctional molecules. Dithiobis(3-mercaptopropionate) can be synthesized by reacting bis(sulfanylmethyl)amine with sodium azide in an acidic solution. The cross-linking reaction will produce a disulfide bond, which is a covalent linkage between two cysteine residues in two different polypeptides or proteins. This crosslink is irreversible, so it cannot be broken down by chemical processes, but can be broken down by enzymatic digestion.</p>

<p>Please enquire for more information about Ac-Val-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>

<p>H-Arg-Val-OH acetate salt is a recombinant humanized monoclonal antibody that binds to the serine protease, which is an enzyme that cleaves proteins at specific sites. The antibody inhibits the activity of this enzyme and prevents the release of proteins from cells. It has been shown to be clinically relevant in treating heart failure, chronic pulmonary disease, and congenital heart disease. In addition, H-Arg-Val-OH acetate salt inhibits the release of inflammatory molecules like interleukin 6 (IL6) and tumor necrosis factor alpha (TNFα), which are involved in a variety of diseases.</p>

<p>Please enquire for more information about (Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>12-Doxyl stearic acid is a fatty acid that inhibits the vasoactive intestinal peptide (VIP). The inhibitory effect of 12-Doxyl stearic acid on VIP was demonstrated by incubating the cells with this fatty acid and measuring the change in mitochondrial Ca2+ concentration. This inhibition was shown to be due to the inhibition of fatty acids and not an effect on Ca2+ ion channels. Fatty acids are important for normal cellular function, such as maintaining membrane fluidity and aiding in signal transduction. 12-Doxyl stearic acid has been shown to inhibit the production of cardiac fatty acids and may be useful in treating cardiac disorders. 12-Doxyl stearic acid also has a fluorescence probe that can be used to study how cells react to different conditions, such as changes in water vapor or pH levels.</p>

<p>N,N'-Dibenzylethylenediamine diacetate is a diagnostic agent that is used to detect penicillin in blood samples. It reacts with the drug by forming a red-colored product, which can be detected with an ultraviolet light. This reaction is inhibited by cefapirin sodium and benzathine. The detection of penicillin in maternal blood has been shown to be significantly higher during the first trimester of pregnancy than during any other time period. Penicillin has also been shown to be effective against syphilis and streptococcal pharyngitis (strep throat), although it is not recommended for treatment trials because of its tendency to cause allergic reactions.</p>

<p>Please enquire for more information about Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Ile-His-Thr-EDANS acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Chloropyridine-4-boronic acid is a nicotinic acetylcholine receptor antagonist that has been shown to be effective against trypanosomiasis. It blocks the binding of acetylcholine to its receptor, which prevents the propagation of an action potential in the postsynaptic cell. 2-Chloropyridine-4-boronic acid inhibits the enzymes cyclooxygenase and prostaglandin synthase, which are involved in inflammation. 2-Chloropyridine-4-boronic acid is potent and selective for nicotinic acetylcholine receptors, but it also binds to other sites on the enzyme. The molecular modeling studies have shown that this compound has a pharmacophore that can be used as a guide for drug design.</p>

<p>2,5-Diaminoterephthalic acid is a synthetic organic compound that is used as a building block for the synthesis of polyamides. It has been shown to have high salt adsorption properties and low detection limits for certain analytes. 2,5-Diaminoterephthalic acid has also been found to have photocatalytic activity and can be used in the treatment of cancer. This chemical reacts with nitro groups on nucleophilic attack to form the carcinogenic nitrosamine. The formation rate of this nitrosamine depends on the presence of methoxy groups and nitrogen atoms in 2,5-diaminoterephthalic acid.</p>

<p>Angiotensin II is a peptide hormone that may act as a neurotransmitter or neuromodulator. It is one of the most important vasoconstrictor and aldosterone-secreting hormones produced by the renin-angiotensin system in mammals. Angiotensin II has been shown to stimulate cardiac contractility, increase vascular resistance, and regulate blood pressure. The effect of Angiotensin II on cardiac contractility is mediated through its binding to a response element in the promoter region of genes encoding for Ca2+ channels. This binding leads to increased Ca2+ influx into cardiac cells and increased myofibrillar Ca2+ sensitivity. Angiotensin II also activates reactive oxygen species (ROS) production, which causes injury to the renal tubular epithelium and induces tubulointerstitial injury in rats with diabetes. It also stimulates squamous cell carcinoma growth by inducing reactive oxygen species (ROS) production and activating signal trans</p>

<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Helical CRF (12-41) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about C5a Anaphylatoxin (human) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,7-Naphthalenedisulfonic acid disodium salt is a heteronuclear molecule that is synthesized by the reaction of 2,7-naphthalenedisulfonyl chloride with sodium sulfite in water. It has been used in the manufacture of dyes and pigments, as a corrosion inhibitor for steel and aluminum, and as an intermediate in the synthesis of pharmaceuticals. The compound has been detected in groundwater samples at concentrations up to 10 mg/L. The compound is also found in geothermal waters at concentrations up to 0.6 mg/L.</p>

<p>Angiotensin I/II (1-7) trifluoroacetate salt is a selective inhibitor of angiotensin II. It blocks the activity of angiotensin II, and thereby prevents the activation of growth factor-β1, which leads to a decrease in pulmonary hypertension. The drug has also been shown to be effective in blocking dextran sulfate absorption, as well as preventing bowel disease by inhibiting receptor activity. Angiotensin I/II (1-7) trifluoroacetate salt has been shown to have an anti-inflammatory effect on the cardiovascular system by blocking cell signaling pathways and reducing blood pressure. This drug is used for treatment of metabolic disorders such as atherosclerotic lesion, cardiac diseases such as coronary heart diseases, and bowel disease.</p>

<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>4-Nitro benzenebutanoic acid is a synthetic molecule that has not been extensively studied in biological systems. It is a calcium-binding molecule and may be used to study the mechanisms of calcium binding. 4-Nitrobenzenebutanoic acid has also shown some bifunctional activity and is used as a substrate in pharmacokinetic studies. The synthesis of this compound can be achieved by reacting azobenzene with butyric acid in the presence of an amine and inulin. This reaction produces nitrobenzenebutanoic acid, which undergoes hydrolysis to yield 4-nitrobenzenebutanoic acid.</p>

<p>Please enquire for more information about Neuropeptide VF (56-92) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>

<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>

<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Biotinyl-Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (403-407) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gliadorphin is a peptide that occurs in cow's milk. It has been shown to be effective against bacterial translocation, which is the passage of bacteria from the gut into other parts of the body. Gliadorphin also has a safety profile, with no observed adverse effects in animal studies and dietary trials. The biological samples used for this study were casein and urine samples. The antibodies used were polyclonal antibodies and Gliadorphin was tested for its ability to bind to bacterial proteins in vivo. Hydration may be necessary for optimal absorption of gliadorphin, as dehydration can affect immune reaction. Gliadorphin does not have any known side effects or drug interactions, but it should not be used by people with an allergy to casein or those who are allergic to mammalian serine proteases (such as trypsin).</p>

<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.</p>

<p>H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.</p>

<p>Please enquire for more information about H-Met-Cys-Glu-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>