Primary Antibodies

Affinity purified Rabbit polyclonal RBM15 antibody

Affinity purified Rabbit polyclonal Syntrophin alpha 1 antibody

RIPK2 antibody was raised in rabbit using the middle region of RIPK2 as the immunogen

DOK7 antibody was raised in rabbit using the C terminal of DOK7 as the immunogen

RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS

Affinity purified Rabbit polyclonal TNFAP1 antibody

CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.

The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to

CDK3 antibody was raised in rabbit using the C terminal of CDK3 as the immunogen

The SCF antibody is a highly specialized monoclonal antibody that plays a crucial role in inhibiting the endocytic uptake of growth factors such as collagen and fatty acids. This antibody acts as a neutralizing agent and specifically targets the low-density lipoprotein receptor-related protein (LRP), preventing its activation by interfering with its binding to growth factors. By blocking this interaction, the SCF antibody effectively hinders the downstream signaling pathways involved in cell proliferation and differentiation.

Affinity purified Rabbit polyclonal EPHX1 antibody

Affinity purified Rabbit polyclonal HSP90B antibody

The PSMC4 antibody is a highly specialized antibody that targets specific proteins involved in various cellular processes. This antibody has been extensively studied for its potential applications in cancer research and therapy.

Affinity purified Rabbit polyclonal PGAM2 antibody

The Calretinin antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and detect the presence of calretinin, a calcium-binding protein found in various tissues and cells. This antibody has been extensively tested and validated for its specificity and sensitivity.

FMO3 antibody was raised in Rabbit using Human FMO3 as the immunogen

Affinity purified Rabbit polyclonal DNA polymerase gamma antibody

Affinity purified Rabbit polyclonal UTP6 antibody

DNAJA3 antibody was raised in Rabbit using Human DNAJA3 as the immunogen

The WNT2 antibody is a polyclonal antibody that specifically targets the protein WNT2. This antibody is widely used in Life Sciences research to study the role of WNT2 in various biological processes. WNT2 is an important signaling molecule involved in cell development, proliferation, and differentiation. It plays a crucial role in embryonic development and tissue homeostasis.

Rabbit polyclonal Aquaporin PIP antibody

Rabbit polyclonal YME1L1 antibody

Rabbit polyclonal VTN antibody

Mouse monoclonal PGAM2 antibody

BUB3 antibody was raised in Rabbit using Human BUB3 as the immunogen

DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVA

FLAG antibody was raised in Mouse using synthetic peptide corresponding to aa(DYKDDDDK), conjugated to KLH as the immunogen.

Rabbit polyclonal GRIN2A antibody (Tyr1325)

Sigma 54 Monoclonal Antibody

C20ORF3 antibody was raised using the C terminal Of C20Orf3 corresponding to a region with amino acids QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL

Rabbit polyclonal Cystatin C antibody (biotin)

Affinity purified Rabbit polyclonal CCDC83 antibody

HSBP1 antibody was raised in Rabbit using Human HSBP1 as the immunogen

Affinity purified Rabbit polyclonal LOC169436 antibody

The STOML1 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor. It specifically binds to the histidine residues on the receptor, blocking its activation and inhibiting downstream signaling pathways. This antibody has been extensively studied in Life Sciences research and has shown promising results in various applications.

Affinity purified Rabbit polyclonal FLJ32786 antibody

The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.

DDIT4L antibody was raised in Rabbit using Human DDIT4L as the immunogen

The Androgen Receptor antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody specifically designed to target the androgen receptor, a steroid receptor protein that plays a crucial role in mediating the effects of androgens in various biological processes. This antibody can be used for a wide range of applications, including immunoassays, neutralizing experiments, and as a probe for detecting the presence of the androgen receptor.

The PTGER1 antibody is a highly specialized polyclonal antibody that is designed to specifically target and bind to the PTGER1 antigen. This antibody is widely used in research and life sciences applications, particularly in the study of alpha-synuclein and its role in various diseases and conditions. The PTGER1 antibody has been shown to have a high affinity for the PTGER1 antigen, making it an ideal tool for detecting and quantifying the presence of this protein in samples. Additionally, this antibody has been extensively validated for use in techniques such as immunohistochemistry, immunofluorescence, and Western blotting. Its exceptional specificity ensures reliable and accurate results, making it an invaluable asset for researchers working in the fields of neuroscience, cell biology, and molecular biology. With its ability to provide detailed insights into the expression patterns and localization of PTGER1, this antibody opens up new avenues for understanding the complex mechanisms underlying various diseases and holds great promise for future therapeutic development.

The XIAP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to X-linked inhibitor of apoptosis protein (XIAP), a glycoprotein that plays a crucial role in cell survival and death pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.

The SAMHD1 antibody is a neuroprotective globulin that is used in the field of Life Sciences. It is a monoclonal antibody that targets SAMHD1, an inhibitory factor involved in various cellular processes. This antibody has been shown to neutralize the activity of SAMHD1 and has potential applications in research and therapeutic development. The SAMHD1 antibody is highly specific and exhibits high affinity for its target. It can be used in various assays, including immunohistochemistry, Western blotting, and flow cytometry. This product is available as a monoclonal antibody with excipients to ensure stability and long shelf life. The SAMHD1 antibody is glycosylated, which enhances its binding efficiency and overall performance. With its unique properties, this antibody offers great potential for advancing scientific discoveries in the field of neuroprotection and beyond.

NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids  PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL

The ATM antibody is a highly specialized monoclonal antibody that has been designed to target and bind to the ATM protein. This protein plays a crucial role in the DNA damage response pathway and is involved in cell cycle regulation, DNA repair, and apoptosis. The ATM antibody can be used in various research applications, including molecular docking studies, immunoassays, and hybridization experiments. It has been shown to specifically recognize and form a complex with the epidermal growth factor (EGF)-like domain of the ATM protein. Additionally, the ATM antibody exhibits high affinity for albumin, a major component of human serum. Its unique binding properties make it an invaluable tool for scientists working in the field of life sciences who are studying cellular processes related to DNA damage and repair.

Rabbit polyclonal RRAGA antibody (biotin)

GEMIN4 antibody was raised in Rabbit using Human GEMIN4 as the immunogen

BRSK2 antibody was raised in Rabbit using Human BRSK2 as the immunogen

The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.

Rabbit polyclonal NUDT12 antibody

The IL13 antibody is a monoclonal antibody that specifically targets and binds to interleukin-13 (IL-13), a growth factor involved in various inflammatory processes. This antibody can effectively neutralize the activity of IL-13 by preventing its interaction with its binding proteins. IL13 antibody has been extensively studied in the field of life sciences and has shown promising results in the treatment of autoimmune diseases, such as asthma and allergic rhinitis.

The TMED2 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It specifically targets the TMED2 protein, which is involved in the transport of cargo proteins between the endoplasmic reticulum and Golgi apparatus. This antibody has been extensively studied in Life Sciences research and has shown promising results in understanding cellular mechanisms.

SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.