Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CD44 antibody (Spectral Red)
CD44 antibody (Spectral Red) was raised in mouse using chicken CD44 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD38 antibody (Spectral Red)
CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen
Purity:Min. 95%Atp11c antibody
Atp11c antibody was raised in rabbit using the C terminal of Atp11c as the immunogenPurity:Min. 95%Goat anti Human IgG (HRP)
Goat anti-human IgG (HRP) was raised in goat using human IgG gamma chain as the immunogen.Purity:Min. 95%RGS13 antibody
RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
HRB antibody
HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN
WDR4 antibody
WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
Androgen Receptor antibody
Androgen receptor antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) E V Q L G L G R V Y P R P P S K T Y R G(21) C of human androgen receptor as the immunogen.
Purity:Min. 95%CIITA antibody
The CIITA antibody is a powerful tool in the field of immunology. This antibody specifically targets and binds to the CIITA antigen, which plays a crucial role in immune system regulation. By binding to CIITA, this antibody can modulate immune responses and has potential applications in various areas of research and medicine.
CTGF antibody
CTGF antibody was raised in rabbit using highly pure recombinant human CTGF as the immunogen.
Purity:Min. 95%Protein S antibody
Protein S antibody was raised in sheep using human Protein S purified from plasma as the immunogen.Purity:Min. 95%AGXT2L1 antibody
AGXT2L1 antibody was raised using the middle region of AGXT2L1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT
Gabrp antibody
Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen
Purity:Min. 95%ARC antibody
The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.
WWP1 antibody
WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
Purity:Min. 95%LIAS antibody
LIAS antibody was raised using the N terminal of LIAS corresponding to a region with amino acids LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG
STK17A antibody
STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)
CD69 antibody (biotin)
CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.
Purity:Min. 95%SLC1A5 antibody
SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
MEPE antibody
MEPE antibody was raised in rabbit using the middle region of MEPE as the immunogen
Purity:Min. 95%Fibronectin 1 antibody
Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIPurity:Min. 95%CD209 antibody
The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.
Purity:Min. 95%anti-Mouse C3 Antibody (FITC)
Please enquire for more information about anti-Mouse C3 Antibody (FITC) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Goat anti Donkey IgG (H + L) (HRP)
This antibody reacts with heavy chains on Donkey IgG and light chains on all Donkey immunoglobulins.Purity:Min. 95%MTCH2 antibody
MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL
TGFB3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Additionally, this drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
